Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007084001
Length(AA) : 458
Localization : scaffold_31
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_05030
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001593603.1| Score: 1153 E_value: 1e-124
KEGG Definition: beta-glucosidase-related glycosidases
Accession: aor:AO090009000554 Score: 1071 E_value: 1e-115
KOG Definition: No Hit Found
PFAM Definition: Glyco_hydro_3_C, Glycosyl hydrolase family 3 C terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933..
Pfam Number: pfam01915 Score: 499 E_value: 6e-51
Swissprot: P48825|BGL1_ASPAC
Gene Ontology:
GO:0008422 = Molecular function: beta-glucosidase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.079NO0.401NO0.071NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1270.0770.834_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01663First60=0.00007PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007084001
MVTRIVATWYKFGQDDGHPEPNFSSWTKNTTGLLYYGSNEPPYAIVNKHV
EARGDHATLARKIAAEAIAMLKNEDVLPLQKPMKVGVYGSDAGPGDGPNA
CPDRGCNQGTLAVGWGSGATDFEYLITPLEAIEKQVGTYGGQVSSVLNNT
KLDEIKADAKKQDICLAFVNADAGEGYISWQDVNGDRPNLKTQLGGDDLI
SAVAEACKATVVVVHSVGPIIMEDWVRSHKVDGILWAHLPGQESGNSLVD
VLWGAVNPSGKLPYTIGKSLEDYGPTAGVLYESNGNPPQQDFTEGLLIDY
RYFDKKDITPRYEFGFGMSYTTFEFSDLNIVRTGSMEPLPKPRPAPEGGN
PALWEIVYTITHTLKNTGKVAGAEVSQLYVNYGSKDTVKFPERVLRGFEK
VFLEPGESKTVTFKLTRRDLSYWDVTKQNWVIPSGGLGVCIGQSSRKFHL
RGNLRYGY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3822 glycosyl hydrolase, putative [Neosartorya fischeri NRRL 181]1e-117


Manual Annotation:

Please find below the necessary files for GSTUMT00007084001 annotation :

link to GSTUMT00007084001 Artemis file
link to scaffold_31 sequence file
link to scaffold_31ESTs