Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006986001
Length(AA) : 419
Localization : scaffold_30
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An11g06730
Specie: [Aspergillus niger]
Accession: ref|XP_001394651.1| Score: 584 E_value: 3e-58
KEGG Definition: hypothetical protein
Accession: ang:An11g06730 Score: 584 E_value: 2e-58
KOG Definition: Transcription factor CA150
Classification: [Transcription].
Kog Number: KOG0155 Score: 413 E_value: 5e-41
PFAM Definition: No Hit Found
Swissprot: Q09685|DRE4_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0006260 = Biological process: DNA replication

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.059NO0.166NO0.059NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5240.0680.379M523

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00052First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006986001
MVPWVLVTTKKGRKFVHNTTTKASLWKAPEDVQAAIDAMPPEEDQPKERK
KGKSKEAATLEGGSGNEVRSEQEERRRVASVAVAAAAALKMEEGRGGSLD
RAKQGPVEFTEDDVAWQLEAIAQEYGFDEEDLDEGEEMTDEDNIYLFKEM
LAEYKVNPYSTWEKEMPRIVEDSRYVLINTTRARKGVFINWCRERIAELK
IEKEKTKKQDPRIPFWEFLKGNASAKLYWPEFKRKWKKSSEMKASKVPDK
DKEKMYREYISHMKISEPLRENDLKKLLRSTTTLSRHTTLETLPDSILVD
VRYITAPDNIRGKVIQDHLATLPEDLEEEKGRKERERREQALRDRERAVR
KEQWKFRGEEQRAKEMLKEEEAMIERAKVVGKRGLLGHITKKEGTAEGVK
DDNEGTPKLDEPGWWAPAE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB61YP20FM1 FF domain protein [Aspergillus clavatus NRRL 1]2e-41


Manual Annotation:

Please find below the necessary files for GSTUMT00006986001 annotation :

link to GSTUMT00006986001 Artemis file
link to scaffold_30 sequence file
link to scaffold_30ESTs