Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006942001
Length(AA) : 431
Localization : scaffold_30
Number of EST contigs matching the gene: 6
Number of ESTs : 220
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein HCAG_09029
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001536078.1| Score: 1254 E_value: 1e-136
KEGG Definition: hypothetical protein
Accession: ang:An11g02770 Score: 1254 E_value: 1e-136
KOG Definition: Uncharacterized conserved protein
Classification: [Function unknown].
Kog Number: KOG1843 Score: 938 E_value: 1e-102
PFAM Definition: DUF500, Family of unknown function (DUF500). Proteins in this family often also contain an SH3 domain (pfam00018), or a FYVE zinc finger (pfam01363)..
Pfam Number: pfam04366 Score: 436 E_value: 1e-43
Swissprot: Q9URW6|YIE2_SCHPO

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.058NO0.120NO0.062NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7150.0890.238M322

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.63724First60=0.19623PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006942001
MGINNPLPASLRSECRKASRILASFVDPKQSFGPDKIIPPSVLSNAKGLA
IITVLKAGFLFSGRVGSGLVVARKGDGSWSAPSAIATAGAGFGGQIGAEL
TDFVMILNDSNAVKTFAQVGSITLGGNVSVAAGPVGRNAEASGAASLRSI
AGIFSYSKTKGLFAGVSLEGSVIVERKDANKKFYGGNVSAKQLLSGSIGP
PHDADALIRILNSRVFSGNLTGMNYDDMYNDIPTYDSDKDESIWEGQSGN
AYGEGTRRGSIGNRNLSRSSTWKDDRDSGSPRVVSRASTWQDDVYDRDRD
RGRDDPADSAWRASHRPDPAQTFDKYESSKSTQFQRQHFNSTYSDKSPSP
KRPTGPKPVFKPKPLFTNKAELNANQAIALYTFEADQPGDLGFKKGDIIT
IVKKTDSKNDWWTGEINGKTGIFPSNYVETM

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1338 DUF500 and SH3 domain protein [Aspergillus fumigatus A1163]4e-55
Contig1430 hypothetical protein HCAG_09029 [Ajellomyces capsulatus NAm1]1e-135
Contig3752 hypothetical protein [Yarrowia lipolytica]1e-79
SY0AAB10YN08FM1 conserved hypothetical protein [Neosartorya fischeri NRRL 181]2e-16
SY0AAC32YF05FM1 hypothetical protein FG09497.1 [Gibberella zeae PH-1]5e-50
SY0AAC34YI12FM1 hypothetical protein NCU03888 [Neurospora crassa OR74A]1e-76


Manual Annotation:

Please find below the necessary files for GSTUMT00006942001 annotation :

link to GSTUMT00006942001 Artemis file
link to scaffold_30 sequence file
link to scaffold_30ESTs