Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006815001
Length(AA) : 888
Localization : scaffold_3
Number of EST contigs matching the gene: 3
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_03021
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001558357.1| Score: 947 E_value: 1e-100
KEGG Definition: hypothetical protein
Accession: fgr:FG01359.1 Score: 856 E_value: 1e-89
KOG Definition: Predicted translation elongation factor
Classification: [Translation
Kog Number: KOG1143 Score: 548 E_value: 3e-56
PFAM Definition: No Hit Found
Swissprot: Q3UJK4|GTPB2_MOUSE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.101NO0.215NO0.083NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2680.050.708_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02333First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006815001
MSSIFTFNPSPPKPASPWANNTPAHPTPSTTPNPKAGSPDLIDDGAPGHL
RANNNSGKIRKHFMEDGDREGVVISSGKMVKGLAAEPQMGATEYKLSLAR
GGKSEARLDQLVTQLLWRLQQSSPYHANSLDSKSPEAISSLVQESQGALY
EIGVADDGKLIGLCEEELQESLDTLHIMAARLGCTVRVLRKEAVGTGQMD
EQNVEGVGFSGSEESFGIPKVGDPLWVVEAFVQPGHGQNCTPRGPAPEQN
VAQPGIRRKTEQLRITLTGATTCGKTTLLGTLSTGEHDNGRGKSRISLLR
HRHELVSGITSSVTWEILGYMPEVSKAELKSASRNGGPSRLVNYASGNIS
SWTDIHAAADGGRIVFLSDSAGNPKFSRTTFKSLIGWAPHYAAFLVTAND
DETLGAEVSSGLSKASLAHLNLCLELGLRMIVVFTKRDLGTKTGLKKVFG
NLLTILKQGGRKPAPLSTSASVKDVVKLVEGDPEHTVPILFTSSVNGQGV
DLLHELIMRLPVPEPPEAPRAVVMEEDCGLSTLFHLEEIYGFQPAHSAED
GNRGAVVGGHVKYGKISIGDELLVGPLTPVDHTSNPPSAEGTPATPAPHP
LLSPSVGHLPGLMSKSPDSANETRATSRKRSGLKITRGDDTVHSSASGED
WEWKLVKVVSVRRLRLPVNILFAGEAGTLGIMPIQPAPHLDTPLAGPVPN
SQLHLSGLGCETKSKNSNDTIKLQNGSLGTPANSAKAVAFANLQTIAPPV
LSTKLRKGMVIFNRPSSFAASSCPQGYTGFTTNLGDEANSLISGSSVVVY
IASIRAIARLVSIEPLLIRSDEIFSLDYDEEIKEAKHADGEGVGRKFMFE
FDQGRAEWIEVDDKVLIVPGGGKRGLDVFAGRVVERLF

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA53YK15FM1 hypothetical protein CHGG_00913 [Chaetomium globosum CBS 148.51]2e-13
SY0AAB34YN05FM1 hypothetical protein SNOG_15753 [Phaeosphaeria nodorum SN15]9e-08
SY0AAC31YE16FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006815001 annotation :

link to GSTUMT00006815001 Artemis file
link to scaffold_3 sequence file
link to scaffold_3ESTs