Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006794001
Length(AA) : 332
Localization : scaffold_3
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : Tmelcrf2  [+]

Blast Results:

Nr Definition: hypothetical protein AN3914.2
Specie: [Aspergillus nidulans FGSC A4]
Accession: ref|XP_661518.1| Score: 722 E_value: 2e-74
KEGG Definition: hypothetical protein
Accession: ani:AN3914.2 Score: 722 E_value: 1e-74
KOG Definition: WASP-interacting protein VRP1/WIP
Classification: [
Kog Number: KOG4462 Score: 112 E_value: 3e-06
PFAM Definition: Glyco_hydro_16, Glycosyl hydrolases family 16..
Pfam Number: pfam00722 Score: 442 E_value: 2e-44
Swissprot: Q8J0P4|CRF1_ASPFU
Gene Ontology:
GO:0005886 = Cellular component: plasma membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.929YES0.989YES0.890YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2450.8260.018S320

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.03466First60=1.65837PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006794001
MRAIVFRFVAASLFAALTNAQTFTDCNPMLKTCPPDPALSGIYQHTYGGE
APNFKYLSSKDSVKYGGKDGAVFRIAKPKDAPTIISSFYIMWGRYEVVLK
AAPGAGIVSSIVLQSDDLDEIDWEWLGGKPGEAQSNYFGKGNTATYDRGA
VHPIDSQARFHKYGIDWTAEKIDWLIDDVVVRTLKPSQVKGDFYPQTPMT
ARIGSWAGGDPDNEQGVIDWSGGPTDFTKGPFDMFVQSIYVRDYSTGKEY
IYTDKSGSAASIKSNGGSIMGGGANPGTPNLSSSSSAALSSGSSGSFNAP
SNSGRLSSTASKSHPKITLAILAATLAAIWFY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1534 No hit found
Contig3125 hypothetical protein MGG_09918 [Magnaporthe grisea 70-15]2e-33


Manual Annotation:

Please find below the necessary files for GSTUMT00006794001 annotation :

link to GSTUMT00006794001 Artemis file
link to scaffold_3 sequence file
link to scaffold_3ESTs