Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006718001
Length(AA) : 234
Localization : scaffold_29
Number of EST contigs matching the gene: 9
Number of ESTs : 153
  User annotation : TmelGsto1  [+]

Blast Results:

Nr Definition: glutathione S-transferase, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001265610.1| Score: 556 E_value: 2e-55
KEGG Definition: hypothetical protein
Accession: ang:An07g01100 Score: 542 E_value: 5e-54
KOG Definition: Glutathione S-transferase
Classification: [Posttranslational modification
Kog Number: KOG0406 Score: 246 E_value: 5e-22
PFAM Definition: GST_N, Glutathione S-transferase, N-terminal domain. Function: conjugation of reduced glutathione to a variety of targets. Also included in the alignment, but are not GSTs: * S-crystallins from squid. Similarity to GST previously noted. * Eukaryotic elongation factors 1-gamma. Not known to have GST activity; similarity not previously recognised. * HSP26 family of stress-related proteins. including auxin-regulated proteins in plants and stringent starvation proteins in E. coli. Not known to have GST activity. Similarity not previously recognised. The glutathione molecule binds in a cleft between N and C-terminal domains - the catalytically important residues are proposed to reside in the N-terminal domain..
Pfam Number: pfam02798 Score: 123 E_value: 9e-08
Swissprot: O09131|GSTO1_MOUSE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.345NO0.687NO0.270NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3260.1750.319M518

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.06475First60=0.00064PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006718001
MSITLYTSRICPWAHRAHIALAELGLDFKEVTIDLMKPREPWYLEINPRG
LVPSLKYNDEIITESSIVATFLAELKENHLVPFPGTPEAALKRAKINFFV
DTYFTKAQPLIQSALVTTDMAAKARYANECVDVIEKQLAPLLADAKPFFG
GSSRLTLAEVLTASFVVRLYTYAKPGVDFFPQEAIEMIRKIGNWQKWADA
LLAHESVMAIYVEEDVVRALKIKLAQMAAAAAQK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1511 glutathione S-transferase, putative [Neosartorya fischeri NRRL 181]3e-51
Contig2131 glutathione S-transferase, putative [Neosartorya fischeri NRRL 181]2e-53
Contig3216 glutathione S-transferase, putative [Neosartorya fischeri NRRL 181]3e-55
Contig3535 glutathione S-transferase, putative [Neosartorya fischeri NRRL 181]2e-44
Contig3571 hypothetical protein An07g01100 [Aspergillus niger]9e-29
SY0AAA50YE05FM1 glutathione S-transferase, putative [Neosartorya fischeri NRRL 181]2e-48
SY0AAA62YI07FM1 hypothetical protein SNOG_06360 [Phaeosphaeria nodorum SN15]3e-12
SY0AAB6YA08FM1 glutathione S-transferase, putative [Neosartorya fischeri NRRL 181]4e-48
SY0AAD30YN11FM1 glutathione S-transferase, putative [Neosartorya fischeri NRRL 181]2e-27


Manual Annotation:

Please find below the necessary files for GSTUMT00006718001 annotation :

link to GSTUMT00006718001 Artemis file
link to scaffold_29 sequence file
link to scaffold_29ESTs