Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006688001
Length(AA) : 630
Localization : scaffold_29
Number of EST contigs matching the gene: 3
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An08g07030
Specie: [Aspergillus niger]
Accession: ref|XP_001392818.1| Score: 481 E_value: 5e-46
KEGG Definition: hypothetical protein
Accession: ang:An08g07030 Score: 481 E_value: 2e-46
KOG Definition: Uncharacterized conserved protein
Classification: [Function unknown].
Kog Number: KOG2236 Score: 465 E_value: 6e-47
PFAM Definition: NAF1, NAF1 domain. This domain is involved in snoRNP biogenesis..
Pfam Number: pfam05492 Score: 392 E_value: 2e-38
Swissprot: P53919|NAF1_YEAST
Gene Ontology:
GO:0005654 = Cellular component: nucleoplasm
GO:0005515 = Molecular function: protein binding
GO:0003723 = Molecular function: RNA binding
GO:0000493 = Biological process: box H/ACA snoRNP assembly
GO:0016074 = Biological process: snoRNA metabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.060NO0.088NO0.042NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1370.0370.903_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00014First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006688001
MHTRLAGPTRNNETDTNEAESVKSHDSIEYSPRLPDPFPSTIPSDTAVNP
AAPGPVAPETDITMKGAEDEGSEGPQRKIKQEEASSELDLNYPPPADATS
QTKAPAERVKKPIDPDFLEAAQENKGNPDSEWQFSSDDEVSDEEALSEVL
SADEEDSDEEGCYSPMNAAEMAQLLMREDGGYENSPSVCTPHRTKNELAE
DEAEPDKPNILLTQDMAIKPVGFVKSVVGKLVLIEASDPGHQRVLGEGSV
LALEDRTILGVVDEVLGRVEMPLYTVRFKSPEEIEELGVNVERKVFSVVQ
HSEFVFTQPLKAMKGSDASNLYDEEVPITEQEFSDDEAEAEHKKSLKEAR
QEKRGDRGSGRGDSGGGSTRGRYGGGRGWGSREPVPIHIDEPYIPLARPA
NLQEMYMSPPPPPPSTRGGQRGSNRKRGDKGRSRGSHRSKDSFAGRGGRR
GSHSQSDYDRPQSSSPVPTFGPQPNQPSPNFQQPYPYTFPPRWPAPEQQA
EFIRLMQGQTSQWPSTHQFPMGPPFSLAPHPQHQQFQQQQAVYQTQQQQG
SHFAGQSNPQQQQFRNLPTGAYINPAFWGRQGQAPQAQASQAHTNSNPPA
PTQQIPGSAHETATTRTVRESLEILKNLSK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig818 hypothetical protein SS1G_01371 [Sclerotinia sclerotiorum 1980]5e-43
Contig5427 No hit found
SY0AAC10YM12FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006688001 annotation :

link to GSTUMT00006688001 Artemis file
link to scaffold_29 sequence file
link to scaffold_29ESTs