Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006668001
Length(AA) : 152
Localization : scaffold_29
Number of EST contigs matching the gene: 3
Number of ESTs : 20
  User annotation : Tmelubc2  [+]

Blast Results:

Nr Definition: ubiquitin conjugating enzyme (UbcB)
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_751295.1| Score: 767 E_value: 3e-80
KEGG Definition: hypothetical protein
Accession: ang:An06g01120 Score: 767 E_value: 1e-80
KOG Definition: Ubiquitin-protein ligase
Classification: [Posttranslational modification
Kog Number: KOG0419 Score: 712 E_value: 2e-76
PFAM Definition: UQ_con, Ubiquitin-conjugating enzyme. Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine..
Pfam Number: pfam00179 Score: 516 E_value: 1e-53
Swissprot: Q4WLA7|UBC2_ASPFU
Gene Ontology:
GO:0004842 = Molecular function: ubiquitin-protein ligase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.259NO0.375NO0.154NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7240.0420.246M3111

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.08608First60=0.08456PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006668001
MSTSARRRLMRDFKRMQTDPPAGVSASPISDNVMTWNAVIIGPVDTPFED
GTFRLVMHFEEQYPNKPPSVKFISQMFHPNVYATGELCLDILQNRWSPTY
DVAAILTSIQSLLNDPNTSSPANVEASNLYKDNKREYVKRVRETVEKSWE
GC

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2995 ubiquitin conjugating enzyme (UbcB) [Aspergillus fumigatus Af293]1e-79
SY0AAC42YF22FM1 ubiquitin-conjugating enzyme [Clonorchis sinensis]2e-10
SY0AAD6YH20FM1 hypothetical protein CHGG_04528 [Chaetomium globosum CBS 148.51]5e-52


Manual Annotation:

Please find below the necessary files for GSTUMT00006668001 annotation :

link to GSTUMT00006668001 Artemis file
link to scaffold_29 sequence file
link to scaffold_29ESTs