Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006625001
Length(AA) : 224
Localization : scaffold_29
Number of EST contigs matching the gene: 5
Number of ESTs : 308
  User annotation : Tmelgst2  [+]

Blast Results:

Nr Definition: hypothetical protein ATEG_06384
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001215562.1| Score: 561 E_value: 5e-56
KEGG Definition: hypothetical protein
Accession: ang:An07g02310 Score: 550 E_value: 5e-55
KOG Definition: Glutathione S-transferase
Classification: [Posttranslational modification
Kog Number: KOG0867 Score: 382 E_value: 9e-38
PFAM Definition: GST_C, Glutathione S-transferase, C-terminal domain. GST conjugates reduced glutathione to a variety of targets including S-crystallin from squid, the eukaryotic elongation factor 1-gamma, the HSP26 family of stress-related proteins and auxin-regulated proteins in plants. Stringent starvation proteins in E. coli are also included in the alignment but are not known to have GST activity. The glutathione molecule binds in a cleft between N and C-terminal domains. The catalytically important residues are proposed to reside in the N-terminal domain. In plants, GSTs are encoded by a large gene family (48 GST genes in Arabidopsis) and can be divided into the phi, tau, theta, zeta, and lambda classes..
Pfam Number: pfam00043 Score: 146 E_value: 2e-10
Swissprot: O59827|GST2_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0004364 = Molecular function: glutathione transferase activity
GO:0046982 = Molecular function: protein heterodimerization activity
GO:0042803 = Molecular function: protein homodimerization activity
GO:0006979 = Biological process: response to oxidative stress

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.145NO0.380NO0.125NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3770.0850.535_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01452First60=0.01051PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006625001
MSPPSITLYSHRAGPNPWKVDIVLRHLNIPFETVFIGINGEHKRPPYTNI
NPNGRVPSLIDHSNNDFTIWESGAIMQYIVQKYDKEHKLLFDNFEDNMHV
EQWLMFQMSGQGPYYGQAAWFTRYHPEKVPSAIDRYVKEIKRVLGVLDAW
LADKEYLVGGRLSIADIAFVPWHEALGFLDNEEVNNWKKEFPNAAAWHER
VMALPAAKASFEAKRKAGEAQQKQ

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1162 hypothetical protein ATEG_06384 [Aspergillus terreus NIH2624]5e-43
Contig1326 glutathione S-transferase, putative [Aspergillus clavatus NRRL 1]2e-55
Contig2235 glutathione S-transferase, putative [Aspergillus clavatus NRRL 1]6e-46
Contig5020 hypothetical protein ATEG_06384 [Aspergillus terreus NIH2624]2e-55
SY0AAA42YG02FM1 hypothetical protein SS1G_01918 [Sclerotinia sclerotiorum 1980]1e-40


Manual Annotation:

Please find below the necessary files for GSTUMT00006625001 annotation :

link to GSTUMT00006625001 Artemis file
link to scaffold_29 sequence file
link to scaffold_29ESTs