Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006583001
Length(AA) : 690
Localization : scaffold_28
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_05548
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001555873.1| Score: 494 E_value: 2e-47
KEGG Definition: ankyrin
Accession: aor:AO090138000202 Score: 494 E_value: 8e-48
KOG Definition: Ankyrin repeat and DHHC-type Zn-finger domain containing proteins
Classification: [General function prediction only].
Kog Number: KOG0509 Score: 173 E_value: 5e-13
PFAM Definition: No Hit Found
Swissprot: Q71S21|INVSB_XENLA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.097NO0.472NO0.081NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.050.2240.888_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=21.3816First60=0.01682PredHel=1
Topology=(639-661)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006583001
MAETPIEVLGAFEHARKYADGCRLQLSEILTMLVGYLSNLKQNFICIDTL
DEFPQKERPELWMSLRRLTQECPGTRLFLTGRPHIGDEVRRYFPETVEVL
QIDTRAGDVGLYLRARLDRDPELGAMNEELEADILKVIPEKISGIFLLIR
INMDAILAEPTIRRRRRVLDRMTNGRGLEDAYSTTMERIRQQGGSKARLG
MEALMWICHCERPLSPDELCHALGVELGAEALDISNVPSIQTVLSYTLGL
ITIDEKESTVRLLHYTLHEYLREHLTLFVATHSMMAEVCLTYLNSALVRA
LPPNPDNVCLTPPFLEYAACFWGTHAAMEVTETLKFLALRLLDGYEGHVS
ASVLWQKKIHKPGLAGHVRGISGLHCIAFWGIAEIAIAMLETKRWDVDAR
DSRGDTALMWALRYKNDKVAELLLARSEIKPGVVVTGGNAVHSFTSQWGN
EGVVKLLVEHTDINPNLSDNCGRTPPAFAATSGQGGVVKLLLEGRGVNPD
APDSKGLTPLSYATIGGREDIVRLFRERGDANPDPSDSNERSPISPDTEH
RHQCALKLPSKYGNPGSEAPGTRDRTPVSIPDEGTPGQVAVPLPTPGVPT
PYSTDDLLLDASNSRPATPRPPQEQSLSRKQSLLNQPDSDSASSILYSIL
RSSLAIFFSLLPLLLLLVFHGYGDSHRLSHLTSRTWQWLI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1366 unnamed protein product [Aspergillus oryzae]2e-31


Manual Annotation:

Please find below the necessary files for GSTUMT00006583001 annotation :

link to GSTUMT00006583001 Artemis file
link to scaffold_28 sequence file
link to scaffold_28ESTs