Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006472001
Length(AA) : 275
Localization : scaffold_27
Number of EST contigs matching the gene: 2
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_00185
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001598099.1| Score: 470 E_value: 3e-45
KEGG Definition: hypothetical protein
Accession: cal:CaO19.6175 Score: 373 E_value: 2e-34
KOG Definition: Uncharacterized conserved protein
Classification: [Function unknown].
Kog Number: KOG3100 Score: 359 E_value: 5e-35
PFAM Definition: Fcf2, Fcf2 pre-rRNA processing. This is a family of eukaryotic nucleolar proteins that are involved in pre-rRNA processing..
Pfam Number: pfam08698 Score: 346 E_value: 2e-33
Swissprot: Q12035|FCF2_YEAST
Gene Ontology:
GO:0005730 = Cellular component: nucleolus
GO:0000480 = Biological process: endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA
5.8S rRNA
LSU-rRNA)
GO:0000447 = Biological process: endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA
5.8S rRNA
LSU-rRNA)
GO:0000472 = Biological process: endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA
5.8S rRNA
LSU-rRNA)

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.015NO0.033NO0.018NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0770.0320.951_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00036First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006472001
MPTEETPGLHKESAEAEAVPEGNRIDVVEGPPARLFSSSHVRSDGFGDDV
AELSDETVGRLLSEAEERMKSSSKTLSTSSSTNRSKTLMTKFPKLNPGAS
LPKAPIKSQGAVSRISDPSLLVPSSDRKLANTSAAAGGVSLVDPALSKKR
LKEDEKTAGLKWFDMPRTNLTPEFKRDLQLIKMRGVLDPHRHYKKDNSSF
PEYSQVGTIVEGNADYFSSRLRNKERKRTIAEEVMADDSSRKRFKNKYEE
IQRKKRSGKKEFYKKLKQQRKKSSV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1773 hypothetical protein SS1G_00185 [Sclerotinia sclerotiorum 1980]4e-45
SY0AAB37YN04FM1 predicted protein [Ajellomyces capsulatus NAm1]6e-22


Manual Annotation:

Please find below the necessary files for GSTUMT00006472001 annotation :

link to GSTUMT00006472001 Artemis file
link to scaffold_27 sequence file
link to scaffold_27ESTs