Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006450001
Length(AA) : 666
Localization : scaffold_27
Number of EST contigs matching the gene: 4
Number of ESTs : 10
  User annotation : TmelSTE-A  [+]

Blast Results:

Nr Definition: Ste12-like transcription factor
Specie: [Colletotrichum lagenarium]
Accession: dbj|BAC11803.1| Score: 1906 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: fgr:FG07310.1 Score: 1897 E_value: 0.0
KOG Definition: C2H2-type Zn-finger protein
Classification: [Transcription].
Kog Number: KOG2462 Score: 182 E_value: 5e-14
PFAM Definition: STE, STE like transcription factor..
Pfam Number: pfam02200 Score: 584 E_value: 1e-60
Swissprot: O74252|STE12_EMENI
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0016564 = Molecular function: transcription repressor activity
GO:0000122 = Biological process: negative regulation of transcription from RNA polymerase II promoter
GO:0019953 = Biological process: sexual reproduction

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.067NO0.129NO0.044NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0720.0570.917_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.04263First60=0.00092PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006450001
MYSQHHLANQKPETFMLSTEAQQSLPQDAQVALQQVDNLKYFLISAPVDW
APDQYIRRFLLPTGEYVSCVLWNNLFHISGTDIVRCLSFRFQAFGRPVKN
SKKFEEGIFSDLRNLKSGTDASLEEPKSPFLDFLYKNNCIRTQKKQKVFY
WYSVPHDRLFLDALERDLKREKMGQEATTVAVSEPALSFEFDSSQSLFEQ
LTKAQQANSSSFSAHASYSSSTSPVMRAMDSMPPPQIIPHSMPVVHEDMG
QMGSYPQIPMSLPAPVKREDEFSVGPYYPSDRTGMPLSRPMHQRTVSMPS
YLEYSPAPSFAPSEDYSARGISYEPVTPPQQMVQLSEPHYLAHDGNVYNT
LPDHTGANALHGMIQLPLPPVSGAPPFNSTPRAYSNNVYSVIEGSPTYKQ
RRRRSSITPGVSSLAHATNAATGHTRRASDHLRRSATASVVPMSDHGSDS
DSPPVNMGMQMPPREIVDLSRHGTPLSYVEDHSPAPHSSMIQQQHEDSSL
PPTSNCDQSEYGAGSEIKRPGAIRRAKSATVMEVGPYPQKSHSCPIPSCG
RLFKRLEHLKRHVRTHTQERPYICNHCNKAFSRSDNLAQHRRTHDRDGTS
GNAENYSGSYSEEDLENEEDQLQTIEDVSETSEHSNYMPQQMPMTGMPPS
MPAPSTLMHPLMQQMG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig572 No hit found
Contig1505 hypothetical protein BC1G_10211 [Botryotinia fuckeliana B05.10]1e-101
Contig1630 transcription factor Fst12 [Gibberella zeae]1e-33
Contig1915 hypothetical protein SS1G_07136 [Sclerotinia sclerotiorum 1980]2e-56


Manual Annotation:

Please find below the necessary files for GSTUMT00006450001 annotation :

link to GSTUMT00006450001 Artemis file
link to scaffold_27 sequence file
link to scaffold_27ESTs