Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006425001
Length(AA) : 326
Localization : scaffold_26
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_01552
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_363626.2| Score: 508 E_value: 2e-50
KEGG Definition: hypothetical protein
Accession: mgr:MGG_01552 Score: 508 E_value: 9e-51
KOG Definition: Putative N2
Classification: [
Kog Number: KOG2793 Score: 116 E_value: 9e-07
PFAM Definition: No Hit Found
Swissprot: Q12367|YL137_YEAST

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.117NO0.499NO0.091NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0520.3420.783_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.18653First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006425001
MPLSTFLPLLHEIHDTYEGSLTPTPIRAVNKKVNKLTTKTPPRPAAHPHP
HPCRIHNPLRHQTSIQRPRLPRSQSPSVLSSPRGGETTGAVLWKVTPIFA
DYLSNPGNAFFSHGVLSSRSTVLELGCGVAGVLGLTLGSSGRVRAYFLSD
QEYVLKLLRRNLEENTPPAVAQRKGGARVKGSAMVRTLAIDWEKDRITRE
HPVLKEGVPFGAVIACDCIYNESLVEGFVEALEEACRELSAASSFSTRAA
GGRDSGSTLSEGAGGEGEAKPTLAVIAQELRSPEVFETWLERFRKSFHTY
RIPDSLLTPEINSSSGYCIHVGILRD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6984 hypothetical protein BC1G_15691 [Botryotinia fuckeliana B05.10]1e-31
SY0AAB29YL10FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006425001 annotation :

link to GSTUMT00006425001 Artemis file
link to scaffold_26 sequence file
link to scaffold_26ESTs