Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006375001
Length(AA) : 585
Localization : scaffold_26
Number of EST contigs matching the gene: 3
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_12593
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001802814.1| Score: 852 E_value: 4e-89
KEGG Definition: mannosyl-oligosaccharide alpha-1,2-mannosidase and related glycosyl hydrolases [EC:3.2.1.113]; K01230 mannosyl-oligosaccharide alpha-1,2-mannosidase
Accession: aor:AO090003000476 Score: 634 E_value: 4e-64
KOG Definition: Mannosyl-oligosaccharide alpha-1
Classification: [
Kog Number: KOG2204 Score: 426 E_value: 2e-42
PFAM Definition: Glyco_hydro_47, Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyse the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2)..
Pfam Number: pfam01532 Score: 656 E_value: 5e-69
Swissprot: P31723|MAN12_PENCI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.873YES0.962YES0.720YESN

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1590.9080.009S227

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=21.1839First60=19.4805PredHel=1
Topology=(12-31)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006375001
MIRPATHRTRFLILAFIVIIYFNYVISPEFGNGGSSFELNHPGSSSRLGI
FGGGRNGGRGKGGGRYGNPIQFDFKGSGRAAGDSKRAGEIKEAMSRTFWK
YRLGAWGSDEIMPISGNGKTTRNGWAATIVDTLTTTAMMGLEEEFKLELN
FTLGIDFSRAADLVDPFETTIRYLGAMISTVELIDNGVVHRGLVSEQERN
ALVAKAMELADKLAPGFDSPSGMIWPRINFSTDKGCREDGREVGLHDHPT
ISPARAGTNWLENRILSKLTGNDIYGKNATRAWNLLTLSVFFSFFLGSLS
GTSEFEAELEILPFSNDSGYRYKEDWPGLAQYVARFVRQLPNVLGVDILG
CLLMPTGVNDRYYEYLIKAQILAPKDRHANVYGERWVKAVESTIQHLAQW
STPGKGRQRGKLFLAQWKNGLLTSEMGHLTCFAGGNFILGGKYLGRKDFV
QFGLDIVDGCHETYVSTITRIGPETFAWTPVDKRIAPVLHPEHEGQREQK
NNAGFWVTNARYLLRPETVESYFYAYRATGNQMYQEWAWDAYKYVIPICC
VMVGGRSTFERPIDFLLLSFFPLVYCSRSPYGAVY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1181 hypothetical protein SNOG_12593 [Phaeosphaeria nodorum SN15]7e-13
SY0AAC59YC02FM1 1,2-alpha-mannosidase [Aspergillus oryzae]5e-46
SY0AAD6YG14FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006375001 annotation :

link to GSTUMT00006375001 Artemis file
link to scaffold_26 sequence file
link to scaffold_26ESTs