Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006320001
Length(AA) : 525
Localization : scaffold_25
Number of EST contigs matching the gene: 3
Number of ESTs : 15
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU09899
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_958624.1| Score: 376 E_value: 6e-34
KEGG Definition: hypothetical protein
Accession: ncr:NCU09899.1 Score: 376 E_value: 3e-34
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.027NO0.067NO0.024NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3220.0490.728_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=4.92251First60=0.00114PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006320001
MSVVSIESSIDRAKKLVRSKIRSMMDECKIRKFAMELHSGLSCYTARESG
YREVLRMARKTISFLRPGQRAAASTRGGTTTSKGSRSLGALFFGLPVELQ
LEVVNKLCFFDLLSLRRTSRKFRELTMHNESHIVRHHIGQWVPLHIMKLY
PPPTDVPPTLGYLTDLAYKQRVSTHLALSLARQIVKEMMGGRQSRRMSKE
ATVYVLNQLRLGMAPLIFALFHFFETYRTRRLEHLWGNDDHDSSMAGLDP
LSSLADKMRLQGDIISQYPDNLLLQVHQMYHLLLHLFMRRMSSPSPSVQR
TLGCWTRQRPPNQAFAKVLILGGIKEVWHIYRIKGFCRRRKALDKYLRKL
DAERTRPPKRKNRSEARATTLQQNKGSSIPPNLDVTAPLHSDHNHPPPPP
LSKLDVDDLTQLWTPAAEHRLIFGGIVGSLEEVRCCGQFVSQLLGGVTES
DDEEDDADGDDSEDDSDDSADDEASPVLAPGGGNTVYSNTLLSADSSWDD
ELAEEDSGLFSDDEGLGLGSVLATV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1616 hypothetical protein NCU09899 [Neurospora crassa OR74A]5e-16
Contig6841 hypothetical protein MGG_06351 [Magnaporthe grisea 70-15]3e-16
SY0AAC50YP21FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006320001 annotation :

link to GSTUMT00006320001 Artemis file
link to scaffold_25 sequence file
link to scaffold_25ESTs