Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006306001
Length(AA) : 122
Localization : scaffold_25
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_01888
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001248117.1| Score: 335 E_value: 4e-30
KEGG Definition: predicted protein; K04798 prefoldin beta subunit
Accession: aor:AO090005001299 Score: 306 E_value: 4e-27
KOG Definition: Prefoldin subunit 6
Classification: [
Kog Number: KOG3478 Score: 325 E_value: 1e-31
PFAM Definition: Prefoldin_2, Prefoldin subunit. This family includes prefoldin subunits that are not detected by pfam02996..
Pfam Number: pfam01920 Score: 252 E_value: 3e-23
Swissprot: P52553|PFD6_YEAST
Gene Ontology:
GO:0016272 = Cellular component: prefoldin complex
GO:0015631 = Molecular function: tubulin binding
GO:0007021 = Biological process: tubulin folding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.025NO0.057NO0.033NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0920.0620.906_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006306001
MAGKMLQDLTDQFQALSKDMSSIVEARQKLDSQLQENRSVQKEFANLADD
AKIYKLVGPVLVKQDKSEAVMNVDKRLEFINSEIARIEKQITDIQEKQER
KKMEIIQVQSQLQQDAQAQVGA

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA54YN11FM1 hypothetical protein CIMG_01888 [Coccidioides immitis RS]4e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00006306001 annotation :

link to GSTUMT00006306001 Artemis file
link to scaffold_25 sequence file
link to scaffold_25ESTs