Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006249001
Length(AA) : 786
Localization : scaffold_25
Number of EST contigs matching the gene: 3
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: Mob1 family protein
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001275459.1| Score: 757 E_value: 6e-78
KEGG Definition: Mob1 family protein
Accession: afm:AFUA_2G11710 Score: 752 E_value: 1e-77
KOG Definition: Cell cycle-associated protein
Classification: [Cell cycle control
Kog Number: KOG1852 Score: 428 E_value: 2e-42
PFAM Definition: Mob1_phocein, Mob1/phocein family. Mob1 is an essential Saccharomyces cerevisiae protein, identified from a two-hybrid screen, that binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Mob1 contains no known structural motifs; however MOB1 is a member of a conserved gene family and shares sequence similarity with a nonessential yeast gene, MOB2. Mob1 is a phosphoprotein in vivo and a substrate for the Mps1p kinase in vitro. Conditional alleles of MOB1 cause a late nuclear division arrest at restrictive temperature. This family also includes phocein, a rat protein that by yeast two hybrid interacts with striatin..
Pfam Number: pfam03637 Score: 276 E_value: 8e-25
Swissprot: Q5F495|MOBL3_CHICK

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.069NO0.240NO0.063NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6140.0620.326M441

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03206First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006249001
MGPSSNPLSSPPRLPSPPPFTEVQISPVPLSLSLSKSPVRPVSNSATRRI
RPGTKSRHIAAGPPLVPLSELESAFQLQEHLASLLAATTSPPGSDTTVPL
SREACERLATPPEGIEEYLWCYELTRRLTRDLNILLVALLKDNCTASSCP
EMRASEWQYLCAVHDPPQSCCAIDYSTHTLDQAATMLCTNRYFPSRLSPH
NTSVKHLASIFRRLYRIFAHAWFQHRSVFWEVENEFGLYLFFKTVSEKYS
LIPEDNLTLPPEAEGLKSKNSFGEVDSDEEEIDEFDRGAGSREHGQELDE
DEDYPDSDESESDEEEADGEEEGELEIENSIEGDEVEDDEFDLDIDDDHS
VEEEGSGNSALTETHGNFKGETRGGEREHNLLLLPSPQSYSLVSLMETYK
LAFGAAFRAAPLDTPSTLDIAVYAPFLSSLNAVRGRHFDKTQHLLARLYS
IVNSVAVEEKRELAVDARIILLSDIGPKEEERASGFGPVIGLRELAKSGR
EWKNIIVGAHSPGSSEGQENREKEEAEGQAIEKAFLCYRGDKVTGYTDVW
RCEIVTLSEEEPKEAVENDKLDDAAVEHLIVAGMPSTSTTSLHPFADPYK
VGGTFDHLHPGHKLLLTMTAFLLSPNAAAPRLVAGITGETLLINKKHSAH
LGSWDSRAAEVVDFLRGITDFSANPSQLLTSPSSSTPETDITPRSITATI
PGGEKELVIETVEINDPFGPTITNEAISALVVSEETKNGGEAVNKKRTEK
SWDALQVYKVDVIDNEGGVKMSSTDIRRKLEERSTA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4420 hypothetical protein BC1G_05308 [Botryotinia fuckeliana B05.10]3e-36
Contig6908 Mob1 family protein [Aspergillus clavatus NRRL 1]5e-24
SY0AAC23YP11FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006249001 annotation :

link to GSTUMT00006249001 Artemis file
link to scaffold_25 sequence file
link to scaffold_25ESTs