Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006245001
Length(AA) : 367
Localization : scaffold_25
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: UDP-glucose 4-epimerase Gal10
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001590586.1| Score: 1431 E_value: 1e-156
KEGG Definition: hypothetical protein [EC:5.1.3.2 5.1.3.3]; K01784 UDP-glucose 4-epimerase; K01785 aldose 1-epimerase
Accession: mgr:MGG_08012 Score: 1413 E_value: 1e-154
KOG Definition: UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase
Classification: [Cell wall/membrane/envelope biogenesis].
Kog Number: KOG1371 Score: 1130 E_value: 1e-124
PFAM Definition: Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilise NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions..
Pfam Number: pfam01370 Score: 474 E_value: 4e-48
Swissprot: P40801|GAL10_PACTA
Gene Ontology:
GO:0004034 = Molecular function: aldose 1-epimerase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.251NO0.625NO0.193NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0270.3860.814_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=7.71222First60=7.70396PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006245001
MSAKEGTVLVTGGTGYIGSFTTLELLVAGYEVIVIDNLYNSSEESLNRIE
RICGKRPIFYKADVTDQEALDKIFKDHPDIDSVIHFAALKSVGESTEIPV
EYYRVNVGGTISLLRSMEANGVKNIVFSSSATVYGDATRYPNMIPIPETC
PIGPTNPYGRTKMMIEMVIEDHVESHPGWNAALLRYFNPAGAHPSGIMGE
DPQGVPYNLLPLLGQVAVGRREKLKVFGTDYASHDGTAIRDYIHVVDLAK
GHIAALNKLRKDKPGCRAWNLGTGKGSTVFEMIGAFSKAVGRDLPYEVVP
RRKGDVLDLTAVPTRANEELGWKAEMTLEQACEDLWKWVSNNPQGYRQMP
PQMLLDALAETRTKLPS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4273 GAL10 bifunctional protein [Neurospora crassa OR74A]1e-121


Manual Annotation:

Please find below the necessary files for GSTUMT00006245001 annotation :

link to GSTUMT00006245001 Artemis file
link to scaffold_25 sequence file
link to scaffold_25ESTs