Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006227001
Length(AA) : 237
Localization : scaffold_25
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : TmelCHO1  [+]

Blast Results:

Nr Definition: hypothetical protein BC1G_11334
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001550561.1| Score: 808 E_value: 1e-84
KEGG Definition: hypothetical protein
Accession: ang:An01g09480 Score: 789 E_value: 1e-82
KOG Definition: No Hit Found
PFAM Definition: CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase. All of these members have the ability to catalyse the displacement of CMP from a CDP-alcohol by a second alcohol with formation of a phosphodiester bond and concomitant breaking of a phosphoride anhydride bond..
Pfam Number: pfam01066 Score: 222 E_value: 3e-19
Swissprot: O94584|YQ7C_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005789 = Cellular component: endoplasmic reticulum membrane
GO:0003882 = Molecular function: CDP-diacylglycerol-serine O-phosphatidyltransferase activity
GO:0007047 = Biological process: cell wall organization and biogenesis
GO:0010512 = Biological process: negative regulation of phosphatidylinositol biosynthetic process
GO:0006646 = Biological process: phosphatidylethanolamine biosynthetic process
GO:0006659 = Biological process: phosphatidylserine biosynthetic process
GO:0032956 = Biological process: regulation of actin cytoskeleton organization and biogenesis
GO:0032465 = Biological process: regulation of cytokinesis

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.050NO0.112NO0.034NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2820.030.78_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=80.5987First60=3.0028PredHel=4
Topology=(72-91,128-150,170-189,204-226)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006227001
MSRRNGTAAANEQKPLVSPEDQAKVSALADDDRHFSMIRALHMADLITEL
NGFCGAMSIFSSLRYCLGSPDDLTQLWLAMTFMPFGLFFDFMDGKVARWR
KKSSLMGQELDSLADLISFGMAPASCAFALGFRTFLDTIILTLFVLCGLS
RLARFNVTVQSLPKDATGKSKYFEGTPIPTTLSIVMAMAYWAHKGWYLGN
LPLGTAGAGLLEFHPAVLIFAASGCAMVSKSIHIPKL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig170 hypothetical protein BC1G_11334 [Botryotinia fuckeliana B05.10]1e-71
SY0AAB31YK20FM1 hypothetical protein SNOG_12017 [Phaeosphaeria nodorum SN15]9e-28


Manual Annotation:

Please find below the necessary files for GSTUMT00006227001 annotation :

link to GSTUMT00006227001 Artemis file
link to scaffold_25 sequence file
link to scaffold_25ESTs