Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006215001
Length(AA) : 674
Localization : scaffold_25
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: No Hit Found
KEGG Definition: No significant hit
KOG Definition: WASP-interacting protein VRP1/WIP
Classification: [
Kog Number: KOG4462 Score: 157 E_value: 4e-11
PFAM Definition: DUF1421, Protein of unknown function (DUF1421). This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function..
Pfam Number: pfam07223 Score: 120 E_value: 8e-07
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.016NO0.032NO0.038NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0730.0340.955_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=11.8356First60=0.00019PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006215001
MDAATLRTTSEEKNDPEAMSSPSSPLETAEATTTPPPTSSSTSQPTTPLT
EATDPWEELSTGTAETSLSATFSVLKGYNRVPIYERRAQWLAEQQSRREQ
VFHHRLALPRGNAGDFNPNADLPFPITAQFLQSYGGGEQERGRRVHWSGN
REGGGSGRTVVAAGMVVGMSEGEEEEYEYEEEGEGTSTIASPVSERSESG
VHALVPSPVHRGEEESGVFRKPRLDRKTSGIPSFDSLFETKWDFDMLIRN
VTHASSKTKKGWVLDEPKTSIRQSKDIPMASSSSSSRVSESSIFGSMHGS
KATFGSYLKYLQSHRRSYSFGMLLFGCLSLVMLQNRFLMAGIMTETPLAQ
ARYAYEGYNASQYATIDFPGLLSTETALEKSLASVAAAPALARLLKQSEI
TVSDLSTVVQHSDLDCKHTLSDLLLKFATQAGDVAGLLQAFESTVSRALT
QLDSANAQTLQHLNHHLPPPLPFYKSLLRKNPHHYYHLLPSQTQHLSTAH
EILAHHINNTLSALAQETGAILRSLRTLSHQHAPIYASIVREFTAIERAQ
TTLWTRARGVDYSESKELLALVGTYEEKARGYVERVGMEYVALRGELVGL
REGLKEAGRVSGGELVPFEAQIRAVRGMVELKRTRDARMSARSGCLGGVG
KRSGGGGAAVGYRGLFKPTKTKIT

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1146 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006215001 annotation :

link to GSTUMT00006215001 Artemis file
link to scaffold_25 sequence file
link to scaffold_25ESTs