Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006187001
Length(AA) : 349
Localization : scaffold_24
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: No Hit Found
KEGG Definition: No significant hit
KOG Definition: No Hit Found
PFAM Definition: Tymo_45kd_70kd, Tymovirus 45/70Kd protein. Tymoviruses are single stranded RNA viruses. This family includes a protein of unknown function that has been named based on its molecular weight. Tymoviruses such as the ononis yellow mosaic tymovirus encode only three proteins. Of these two are overlapping this protein overlaps a larger ORF that is thought to be the polymerase..
Pfam Number: pfam03251 Score: 108 E_value: 9e-06
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.047NO0.054NO0.032NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0990.0690.904_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00167First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006187001
METTSVKSKAKELYPSDYPELTATTARNRPPRSPFPPYPGRLKLSDLSEI
SELSRFSWRSKPSTTKISGAGTTEVPFGIPESPNLPPTPSRCTSADDGLD
LGLSWAEMPELLGINIAEGEGKEGGEYEKEEYWETATSPHELSSSPTLAP
TPTHGGKLRQLPRSSEAPAPLTSSLAPPTPAARRIIQGKGSPLESNTKDT
YIYYHEIGAIISRDPVNEDDSQEEIILLVEVRAGFVAKTNTANTIVICKS
HTEANRLGRSFDNDKWIALVHPRVGKIWLFRIPHVRLLIGGRRPAAKCGI
CEGVIPEGKVAHGCVYTRETVIDGGDTEPVLGKVKKVRFAQVVGVSEAS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1465 hypothetical protein SS1G_08955 [Sclerotinia sclerotiorum 1980]1e-20


Manual Annotation:

Please find below the necessary files for GSTUMT00006187001 annotation :

link to GSTUMT00006187001 Artemis file
link to scaffold_24 sequence file
link to scaffold_24ESTs