Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006171001
Length(AA) : 246
Localization : scaffold_24
Number of EST contigs matching the gene: 2
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_06092
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001555387.1| Score: 717 E_value: 5e-74
KEGG Definition: hypothetical protein
Accession: fgr:FG07481.1 Score: 702 E_value: 1e-72
KOG Definition: Predicted alpha/beta hydrolase
Classification: [General function prediction only].
Kog Number: KOG2382 Score: 533 E_value: 3e-55
PFAM Definition: Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes..
Pfam Number: pfam00561 Score: 203 E_value: 6e-17
Swissprot: O94437|YFI3_SCHPO
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.056NO0.137NO0.071NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5880.0390.486M593

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03041First60=0.00002PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006171001
MHGLFGSKQNNHSISKALARDLNRPVYTLDLRNHGESPHTPQHNYEAMAG
DVEHFLKENKLGPKTALIGHSMGAKTAMTIALRKPSIISSIIAVDNAPIE
AALHSSFGGYVRAMRKIEDSHLAEAKAADAILAEVEPDIAIRQFLLRNLV
RGDGGRLSFRIPVRTLARELDNMATFAYHPDEVRFEKRALFVRGTRSPYI
PDEAIPVIGRFFPLFRLKDIDAGHWVISEKPNEFKEAVIEFLNEEE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1772 hypothetical protein BC1G_06092 [Botryotinia fuckeliana B05.10]3e-55
SY0AAD29YC11FM1 hypothetical protein CHGG_07804 [Chaetomium globosum CBS 148.51]2e-22


Manual Annotation:

Please find below the necessary files for GSTUMT00006171001 annotation :

link to GSTUMT00006171001 Artemis file
link to scaffold_24 sequence file
link to scaffold_24ESTs