Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006165001
Length(AA) : 542
Localization : scaffold_24
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_00426
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001598340.1| Score: 1597 E_value: 1e-175
KEGG Definition: MBOAT family protein, putative
Accession: afm:AFUA_6G04860 Score: 1522 E_value: 1e-167
KOG Definition: Predicted membrane protein
Classification: [Function unknown].
Kog Number: KOG2704 Score: 1125 E_value: 1e-123
PFAM Definition: MBOAT, MBOAT family. The MBOAT (membrane bound O-acyl transferase) family of membrane proteins contains a variety of acyltransferase enzymes. A conserved histidine has been suggested to be the active site residue..
Pfam Number: pfam03062 Score: 476 E_value: 3e-48
Swissprot: O42916|ALE1_SCHPO
Gene Ontology:
GO:0005789 = Cellular component: endoplasmic reticulum membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.326NO0.797NO0.230NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0280.7940.536S436

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=155.889First60=15.6559PredHel=5
Topology=(52-71,78-100,362-384,413-431,446-468)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006165001
MISFIDYPFIWLEGATGAAKDELKLIFTILLSYPFAGVLKRLPDAEPAKK
NLFMIGVSLFYMVGVFNLWGGLRTLSVSAGGAYAIAKFVQGPYMPWIAFV
YLMAHMLISHIERELHGIPGVVDVTGAQMVMVMKLTAFCWSVHDGRLPEK
DLSAFQKDRALPVMPSILDYIAYVLFFPSLFAGPAFDFAEYQRWIDCTMF
DVVSPGATKGSTKRKRKIPKSHRPAIWKAICGLGWIAAFMKFSSWYKTGF
VLDDGFLRYSVLRRVWYIYALGFTERLKYYGVWSLTEGACILSGLGYNGL
DENKRPRWDRLTNVDPWALETAENTRAYLESWNMNTNKWLKNYVYLRVTP
RGKKPGFRSSLVTFGTSAIWHGISPGYYLTFLTASFVQTVAKYFRRHIRP
FFVEPDGKTPGRYKRAYDIFGLLATQIGFSYIVAPFIILDFKNSLIVWGR
LKFFVHIGILLSMLFFNSSGKSWLSQKLKARVGRAASSEGLHKSPSASDF
RGGALGLLDPMKEIEDMQRELLAKEEEVMNRRNSMNTTSKNK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig12 MBOAT family protein [Aspergillus clavatus NRRL 1]3e-66
Contig4619 hypothetical protein SS1G_00426 [Sclerotinia sclerotiorum 1980]8e-74


Manual Annotation:

Please find below the necessary files for GSTUMT00006165001 annotation :

link to GSTUMT00006165001 Artemis file
link to scaffold_24 sequence file
link to scaffold_24ESTs