Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006134001
Length(AA) : 230
Localization : scaffold_24
Number of EST contigs matching the gene: 2
Number of ESTs : 16
  User annotation : No user annotation

Blast Results:

Nr Definition: C6 transcription factor, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001265276.1| Score: 131 E_value: 4e-06
KEGG Definition: hypothetical protein
Accession: ani:AN8590.2 Score: 131 E_value: 2e-06
KOG Definition: Wiskott Aldrich syndrome proteins
Classification: [Cytoskeleton].
Kog Number: KOG1830 Score: 106 E_value: 9e-06
PFAM Definition: Zn_clus, Fungal Zn(2)-Cys(6) binuclear cluster domain..
Pfam Number: pfam00172 Score: 111 E_value: 2e-06
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.044NO0.121NO0.044NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2750.0580.729_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00035First60=0.00004PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006134001
MPKLFLPPRKISEPSKNTSAASSTPVDPGTGSSLNISSSLPPTNVPVVNP
NTRIPPAPPSNTGVVPPTLALPLSPLFADGNPHGKAITPPTLARPSPGQN
RRKGPPRIVACVSCHRQKKKCAGERPCARCVALGVACKEQERPDDGFQYI
RKKKKLKTAKTLDPLPQLPLHPLNHPTPFPGSLWTSMGQQASHDSPAYQN
QLPSPSPSLTMIPVEMMNVVTEAHKRPVVT

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig541 No hit found
Contig1378 C6 transcription factor, putative [Neosartorya fischeri NRRL 181]6e-06


Manual Annotation:

Please find below the necessary files for GSTUMT00006134001 annotation :

link to GSTUMT00006134001 Artemis file
link to scaffold_24 sequence file
link to scaffold_24ESTs