Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006113001
Length(AA) : 782
Localization : scaffold_24
Number of EST contigs matching the gene: 4
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: zinc finger protein
Specie: [Schizosaccharomyces pombe 972h-]
Accession: ref|NP_592812.1| Score: 202 E_value: 1e-13
KEGG Definition: hypothetical protein
Accession: spo:SPAC11D3.17 Score: 202 E_value: 7e-14
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: Q10096|YAOH_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.051NO0.139NO0.042NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8230.0080.424M419

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.56603First60=0.00506PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006113001
MARKNNNRKSPTVASGSRGSGTGAVSQALRLRRWIDIQLKDVLEERARGN
WTEEDEREWRRTKPYECETCNERSSTRYNNNRHKLNKHSTKKVLNCTFPG
CKLVFTRPDNLAKHQKKHHSASQNDPEDEPRDDVEKLTSQFWRRFPIADD
LPKKPVDGLRIYYTPGKLPFLPPEVISHYADYYFAPTAFHPFLPLLHKPT
FQPTTVLASFLRSVCALGGRYDPTNQTLREQLWEAGLRVMERWIERGPDD
GGDLEPPASMSPPPLVKTESPQAMVHPHPPSSSAGDGDRQSVKYADRSQR
EGTLCVLQGLLLFAFYGLFSEEKEKHKKGRVLLARAIARDYGYFSPAPGH
IPQELPPDQQWKIFVERESRKRVAFTIYLVDCYVSFTFETPRLLRHTELR
NLPLPCDAQLFEAPTAQAWNHKYYTMRIHGSRMVPPPLFLKTLRILLNGN
GHHELLDAGGLGSNFSALILATAIQMEILDLTRKVADDIDAQYETGILAL
EEGAAWEGVDVFAPESQEGLEKLRMGLTTLGLISGIGNLFTPYAEHLTVF
PPVTTYASTSPTLLASALQGCEKAFYILMHLALVQLVIPDRMVLHKKDVP
MDLYTALASTVHGAKARVAANNPATLQHFMHVLDQSNVLSHLLSLLRVLL
APQSAYDENARNTEFPIVTVLIFKALMVVWEIIVRVENPPSPQEEMYLWH
AYGLDGSPNQVFTQDMVVKPVDAFRYELLGLLVQWEVRNEETEGLESLEW
RYLRWMKAVFTEMEQWGVGEGVVQALDYGLFG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1558 zinc finger protein [Schizosaccharomyces pombe 972h-]1e-10
Contig3551 No hit found
SY0AAD34YH13FM1 No hit found
SY0AAD34YN13FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006113001 annotation :

link to GSTUMT00006113001 Artemis file
link to scaffold_24 sequence file
link to scaffold_24ESTs