Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006093001
Length(AA) : 745
Localization : scaffold_24
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CC1G_01849
Specie: [Coprinopsis cinerea okayama7#130]
Accession: gb|EAU92804.1| Score: 1526 E_value: 1e-167
KEGG Definition: hypothetical protein
Accession: yli:YALI0A05379g Score: 1356 E_value: 1e-147
KOG Definition: Para-aminobenzoate (PABA) synthase ABZ1
Classification: [Translation
Kog Number: KOG1224 Score: 1312 E_value: 1e-145
PFAM Definition: Chorismate_bind, chorismate binding enzyme. This family includes the catalytic regions of the chorismate binding enzymes anthranilate synthase, isochorismate synthase, aminodeoxychorismate synthase and para-aminobenzoate synthase..
Pfam Number: pfam00425 Score: 558 E_value: 1e-57
Swissprot: O94277|PABS_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0008153 = Biological process: para-aminobenzoic acid biosynthetic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.253NO0.681NO0.233NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0620.1690.779_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.35132First60=0.25548PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006093001
MRILLIDAYDSFAQNLAQLLTSATGATVYTIRIDDFADISFLKPHLPSFH
AVVIGPGPGSPEVEADIGVVNDVWKLSGGDVLPVFGVCLGLQSLVFSHGG
RVNRLGTVKHGLLSEIVHTGEGLFEGVGKVNVVRYHSLHGITKIGGDVEE
IAWAYDENGRVVMGVKHISKPFWGVQYHPESVCSEDGRDVVGNFWKMAMD
WNTGQGRVVKELRTDWRGQSREKGLLELQTTLEGRRLDDCQKVEVRTEDI
FGKGISAGRICEILGVEAANEFILLESAAAPGRFSIIGVLTPGLTQRINY
TCGDTFLKLSYTGRDSSETRIDLRTYGGSIWRFLAKYMDQRKAVGGKDHS
PFWGGLVGYFNYETGVNSLNIPIKPRKEAEGMKRRPDVNLAFVERSIVLD
GHTGRVYIQTLLPPAADGNWLESTKRQLQPEADMAITPSATPPPEPSPEC
HRSFLETSHPKPSPVIYKPDAERYMQKVRTCQSYLSAGDSYELCLTATTK
IHLEPTSPWALYRHLCARNPAPYASYFRLSNVTLLSSSPERFLSWSRTGA
CRLCPIKGTVRKTPTTTYSSASLQLNTPKERAENLMIVDLIRHDLHRLAT
NVSVEKLMVVEEYASVYQLVSVITGSVEPQDNMTGFDVLARSLPPGSMTG
APKKRSVEILQEIEETERGVYSGVLGYWSVCGAGDWNVIIRSAFRYDDEV
VTMEDGGEKEVWRIGAGGAVTALSGPREEWEEMEVKLGEPCSLFC

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig877 para-aminobenzoic acid synthetase [Coprinellus disseminatus]3e-44
SY0AAB11YC05FM1 hypothetical protein NCU06714 [Neurospora crassa OR74A]3e-23


Manual Annotation:

Please find below the necessary files for GSTUMT00006093001 annotation :

link to GSTUMT00006093001 Artemis file
link to scaffold_24 sequence file
link to scaffold_24ESTs