Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006064001
Length(AA) : 764
Localization : scaffold_24
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: GAS2 domain protein
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001270159.1| Score: 286 E_value: 2e-23
KEGG Definition: hypothetical protein
Accession: ang:An15g01550 Score: 275 E_value: 2e-22
KOG Definition: WASP-interacting protein VRP1/WIP
Classification: [
Kog Number: KOG4462 Score: 122 E_value: 6e-07
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.042NO0.116NO0.043NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1660.0690.804_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00033First60=0.00003PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006064001
MSSQFLDTRNGSFDISFSCTSMGEGDQADMSDSMSYLEQEESSEIEIKPV
ATSTPKGNRRLTVSIGLDSIVEVLTPRSTRGQCFDKSDVCRNDGPGLGGF
SGTGERASAVEDSVSSSIIPDEGLGKEMLPIELPEKVTEREISRDPTRAT
SASKNRSVAPCSSTPTLGKGLMKDQKQRFTLGSGSVTPSATTVYKRPTSR
AEARPSSRQGNRPSSRAQEFRPPSRAQDAKVSRPSPRAGLSTPGGPADDG
SNSSTPTGTPAPAVRPMRRLHRDTVSTTGADSDDDDDPRRFLREDTPDMN
NSPDFVRAPKLQVSKRHARQPSNPTSAVTPEKSSRFNTGPYAAEGSTLVL
PTTPILPADLDDKINEILGSLPSKVRLTASNLQKLSESTNRQPPIKPFDL
SSPTGIPGPKSVGSSPSVASEVPSYARPSARRHNSSSPGDIKLYHLHRTD
GQTPIKLYIRLVGENGERVMVRVGGGWADLAEYLKEYVTHHGSKRRVVSE
GRVEIQDLSTHSHHGRTLHPSRSISSFRSVSPGPMGSRPSSPGGNRPSTS
LSMRRPESPMLMKRSESENPSLQINPTTMRGGHNGTLPGNNKTSPTTPPD
EAFPLHPLTAPQLTPPNRSSPSSRPASRPGSSSSAGYRRPTSRLSFSESA
FGDCGSANGCSPPSLLPPPQPLGLAGPKGKYVHPDNQAWVEGMLGQVRKA
SADRRAQLLAATGHYGEGGAEEAVVEGSMVVGGGGGDYGGREFGGRLGEI
GKAGGTKRLFAKKG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1046 hypothetical protein BC1G_12331 [Botryotinia fuckeliana B05.10]5e-20
Contig6989 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006064001 annotation :

link to GSTUMT00006064001 Artemis file
link to scaffold_24 sequence file
link to scaffold_24ESTs