Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005955001
Length(AA) : 753
Localization : scaffold_22
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001538920.1| Score: 1059 E_value: 1e-113
KEGG Definition: SWI-SNF complex subunit (Snf5), putative
Accession: afm:AFUA_2G16840 Score: 1051 E_value: 1e-112
KOG Definition: SWI-SNF chromatin remodeling complex
Classification: [
Kog Number: KOG1649 Score: 556 E_value: 3e-57
PFAM Definition: SNF5, SNF5 / SMARCB1 / INI1. SNF5 is a component of the yeast SWI/SNF complex, which is an ATP-dependent nucleosome-remodelling complex that regulates the transcription of a subset of yeast genes. SNF5 is a key component of all SWI/SNF-class complexes characterised so far. This family consists of the conserved region of SNF5, including a direct repeat motif. SNF5 is essential for the assembly promoter targeting and chromatin remodelling activity of the SWI-SNF complex. SNF5 is also known as SMARCB1, for SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin, subfamily b, member 1, and also INI1 for integrase interactor 1. Loss-of function mutations in SNF5 are thought to contribute to oncogenesis in malignant rhabdoid tumours (MRTs)..
Pfam Number: pfam04855 Score: 515 E_value: 2e-52
Swissprot: Q09699|YA28_SCHPO
Gene Ontology:
GO:0005794 = Cellular component: Golgi apparatus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.026NO0.133NO0.035NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1270.0210.941_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00073First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005955001
MPDTSLPQSPQLDHQQPQKTAASLPSSLKESLAASTSPTSLPSSPTTVKS
ASGGAGGDAPDQKPSQLKNKGKAVQDQTDSDSSEVKSLKRRPSTSALLLD
QYITRDHLHAAAIFTQTEASNNLIRSKRREVDYYQQLRRERQVNPGAVFG
YGYQGYGNGFTDGKSRILYPCQRKRPGGRKARELRLSRSQLQTQADMVES
LVPVRLDIDYDKIKLRDTFTWNMHDRSIPLELFAEQLVEDFHLPLAPALV
QMVANSIREQVTDYHPHVFFADDPLDPTLPYTAYKNDDMRVLIKLNITIG
QHTLVDQFEWDINNSLNSPEEFAQLLTRELSLSGEFTTAIAHSIREQAQL
FTKSLFLTGHPFDGRPVEDEDIRSAMLPSPLSNLFRPAGHAKEYTPLLYE
LSDTEMDRAEKSLSREARRKRRVNRRGGPSLPDLKEVPKTHRSQIVSSVL
PGAVQEVSQLKKTMTSKTVRDGESEDDSSESDMEDVPIEKAIPGYANMTK
RQRIAAQNQLRASTGRSQTPEVASTQREHGHHHRGEHHHTPSHLARASTP
LFSRRPGVPMHTDTQSSQSSPMPPPQTPTPATKAASTPAVSSTPAQPTPT
PAQRPEAGNTPVRSLIVMLKIPSTRRKPPSLEQNAMVPLTCSFSFSTKQP
PPEWLSAAIAELHVLHPADRFEIMMRYTAYDPLTDNPLPPHSTNPNAKYK
YSPRIRCHDCPGKLYTPGPSQSIENFLTHLKNRGHRERVDQRVKLQSKSA
ERS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1 hypothetical protein CIMG_09443 [Coccidioides immitis RS]1e-48
Contig2239 hypothetical protein SNOG_02717 [Phaeosphaeria nodorum SN15]4e-06


Manual Annotation:

Please find below the necessary files for GSTUMT00005955001 annotation :

link to GSTUMT00005955001 Artemis file
link to scaffold_22 sequence file
link to scaffold_22ESTs