Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005953001
Length(AA) : 1394
Localization : scaffold_22
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein AN8255.2
Specie: [Aspergillus nidulans FGSC A4]
Accession: ref|XP_681524.1| Score: 553 E_value: 5e-54
KEGG Definition: hypothetical protein
Accession: ani:AN8255.2 Score: 553 E_value: 3e-54
KOG Definition: DNA damage checkpoint protein RHP9/CRB2/53BP1
Classification: [Replication
Kog Number: KOG3548 Score: 273 E_value: 3e-24
PFAM Definition: Rad9_Rad53_bind, Fungal Rad9-like Rad53-binding. In Saccharomyces cerevisiae the Rad9 a key adaptor protein in DNA damage checkpoint pathways. DNA damage induces Rad9 phosphorylation, and Rad53 specifically associates with this region of Rad9, when phosphorylated, via Rad53 PFAM:PF00498 domains. There is no clear higher eukaryote ortholog to Rad9..
Pfam Number: pfam08605 Score: 170 E_value: 3e-12
Swissprot: P87074|RHP9_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0042802 = Molecular function: identical protein binding
GO:0000077 = Biological process: DNA damage checkpoint
GO:0000082 = Biological process: G1/S transition of mitotic cell cycle
GO:0000723 = Biological process: telomere maintenance

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.050NO0.162NO0.050NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1140.0790.875_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.81936First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005953001
MLQKDHDDSSSIPTTQVLSSSPAPAPLPRGLLVDTPEVGGGTRFSLVDTP
FRMSGNTTFSHDRTGSLRLDLGYSQIDIGETQVDGPEVFAAYEEEEAERA
EVLVAKSPEPMAKCDDSREEEEGETQLDDDPDLRTTYFPENSRFDTPRHP
NGNNSSSSPAKKTTPTPGPGYNPLARVGFGACGEQVGASGGPGRRLHTGL
SLSQMFETTSSPVRPPTGGASLPPTPSKAQLEKVMADSMSRLSSYSTRPR
NQPPHVQQRATTTVRESRSSKGQPNPAEVYVSMQESQEAREESARKRHAR
VSRVTGRKGGGGGGSSSLVFNSSSPVTQGYTQPDPEKGKVDESDDGMISY
EDERKRKVAVARKKGVEEVKKVASSAKTSKSSSLERRSKLRREISGETDR
RRAEILVREREFGEGSPTDPDDETGDEEEGRIVPPLLRQNSRRKSVSPEQ
DPRLSMGSRRSSVPPKPTGSLPNTHIAATSSPGASLDLPTPTVLQTQLDP
VPDWESIHNVEPLRAARRTKSTTSITSQQPSADMPPFRHQTVLPSTIADS
QPAPGLSRQETSMVKTSLKNLPPFNIPSPDTAPAKRGAAAKPGPELVPET
SNLEEPSSGLPLPTSSLTPLPSTLSSPAVGIQRSSPPIALKTPYPSRASE
LRRMKQGATTIPETSPWDRDGMLSPMPPNASQSAPPNSLGFHTSRENMRK
SMQESPVRGKRKRSSAERQGRSVDWGSDAIPNSPSEGGKSLGNTAMKSFA
ALENSSSLLSSRPEPDDLDMVDLVAGLGSDVAQDVAPAQGESATEPPPHK
RARASVGGDNEVTPKASESRRKKTASSAKGKPQPTKSAKSATADTTKRGK
APRKSTGRVSNSKPRTTARKTRSSTSLRGSVVGAAADSPIPMAAPELEDE
LESNNPVFSVASCVAPIVDSSLVSPERVFALFKDVKMCYHPATVLSTDSK
GFIKVVFDDGTEDVLDKEVRSLDLRIGDMVKVDQPSMKKAVWIIVGLKKP
VGEPDTHERVGGRSLTDIRGHAIVTVKPRITPASNSMAEDEVLEVPLTRI
YLNRTLWAQFSKRPYNDIPHRSQILPLRISTPSTTDPTTDGVNQASTTTP
NTPSRNRRTTPITTTTSAKPTGGLFFNMLFALSFGENESEKRTVSHRITS
NGGRLVDNDFEDLFHQETPATAGLTPRTESAYVGFTCVIANKHSRRVKFL
QALALGIPCLAPRWVEDCVRARRLLDWDTYLLPAGESAYLAGAVRSRVME
YVSAREARFLGMVGARRRLLPGGLVVVVMGKGGAGLGRWKPYLFLAYAMG
AGKVLTVQTVEAALDALSRKQDGGLDKEEAEKLEEKEEGGGGGCRLVYVD
ARERKHAERLLHRSGRNVRVVDDEWVIQSLILGKLIAGEQIIFN

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3252 hypothetical protein AN8255.2 [Aspergillus nidulans FGSC A4]2e-27
SY0AAB51YB14FM1 No hit found
SY0AAD4YE11FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00005953001 annotation :

link to GSTUMT00005953001 Artemis file
link to scaffold_22 sequence file
link to scaffold_22ESTs