Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005938001
Length(AA) : 598
Localization : scaffold_22
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: high-affinity nickel transport protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001218345.1| Score: 866 E_value: 1e-90
KEGG Definition: terminal deoxynucleotidyl transferase, putative [EC:2.7.7.-]; K00992
Accession: afm:AFUA_2G08840 Score: 861 E_value: 2e-90
KOG Definition: DNA polymerase IV (family X)
Classification: [Replication
Kog Number: KOG2534 Score: 525 E_value: 7e-54
PFAM Definition: No Hit Found
Swissprot: Q09693|YA26_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0051575 = Molecular function: 5'-deoxyribose-5-phosphate lyase activity
GO:0003887 = Molecular function: DNA-directed DNA polymerase activity
GO:0003899 = Molecular function: DNA-directed RNA polymerase activity
GO:0000166 = Molecular function: nucleotide binding
GO:0006287 = Biological process: base-excision repair
gap-filling
GO:0006303 = Biological process: double-strand break repair via nonhomologous end joining

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.300NO0.524NO0.259NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4480.1020.317M575

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.12409First60=0.0002PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005938001
MSSAPLNLSHLPPTFLLPTRLAQPKANEISSQLRSCKCPLTSNPTDASLF
VGDINMPKRCEFELRGRGLSVSSKASPHAKKVRVVKLKWFTESYEGSKLL
PIDEYIVWTGYVQPSKRPSTVSSPEQNEGQKSALEKDAADRQLRKEILER
ARRDQVRYSEEKAHDTRDDIRKLQEMELLYATGRQRKGINELMAISKPGS
KNGVRQSTPEYEERREKVVSRGRPRLLKEMPDWIQQRNKYSCCRPTPLTS
PNADFISLLDTIKLSRVLTSDGVGIRAYSTAIATLQAYPYPLISPSEVSL
LPGCDGKSSALFEEYITSPDHGLAVVRELEKSPSFNILKLFSSIWGVGPV
GAREFFYDKGWKTLEDIVDHGWGQLTRAQQIGVKYFDEFQSPISRNEARD
IAAVVGKAAAKLRAGMDYTIVGGYRRGKMEIHDVDILLSHTTHSMTTGGV
VKELVSELEASGHITHTLHLGRELNNTTTINAHRYGFDSLEKALVVFLAP
NSGLHRRVDIILAPPVSVGSALLGWTGGTTFERDLRLWCDKEHGWKFTSE
GVFERITGRRVAGVDGTWRVGEKMVEAERRVMEGVGLRWLEPCERCTG

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB8YB13FM1 predicted protein [Ajellomyces capsulatus NAm1]8e-08


Manual Annotation:

Please find below the necessary files for GSTUMT00005938001 annotation :

link to GSTUMT00005938001 Artemis file
link to scaffold_22 sequence file
link to scaffold_22ESTs