Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005895001
Length(AA) : 491
Localization : scaffold_21
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: RNA-binding La domain protein
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001264504.1| Score: 579 E_value: 2e-57
KEGG Definition: RRM domain
Accession: aor:AO090001000218 Score: 573 E_value: 4e-57
KOG Definition: Predicted RNA-binding protein
Classification: [General function prediction only].
Kog Number: KOG1855 Score: 191 E_value: 3e-15
PFAM Definition: La, La domain. This presumed domain is found at the N-terminus of La RNA-binding proteins as well as other proteins. The function of this region is uncertain..
Pfam Number: pfam05383 Score: 179 E_value: 9e-14
Swissprot: P87058|LAH1_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0031137 = Biological process: regulation of conjugation with cellular fusion
GO:0042173 = Biological process: regulation of sporulation
GO:0042779 = Biological process: removal of tRNA 3'-trailer sequence
GO:0006386 = Biological process: termination of RNA polymerase III transcription

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.015NO0.044NO0.017NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0580.0740.938_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00037First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005895001
MGDEVATDMATEVPNLGENVVEPTVEKGEGVKVVEQPAAPEVGVKQGEPV
EENLVEDAVESAVEKDEQVKAESLEQLEDVKSATVEEKDSTTAETKEPPK
LQKKSENIKFDATLLPESDDPAEIRKQVEFYFSDSNLPFDKFLFGLVGKD
NRSVPLKLIRSFKRMRRFTNPEAIVKALRESEALVITGDIGEETIRRKIP
LIINEVENKEGNVESKDSKDKSNHRGYQPTPRQAWDADITGGRKFTDLTI
PRSIYAKGFGAETPTTQIDLENFFAPYGPIACVRLRRTRTGFFKGSIFVE
FKDEDLMKGFMSLEEKPKWNDTDLQWLTKKAYCDGKIQDIKDGKIQPTLH
PPHKSPSNKSGHRGNNQRGNNQRGRGKAGRSGNGGRGGGRHQGSNGRRGN
GGKGRNDRGGPPKIKTTPGGVDGIPLVKTNGSASEADEDNNNKRKAENSA
EVHTEVKKIKQECDNTYIKQECDNTHIKQECDNTHIKQEAA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1334 hypothetical protein MGG_01519 [Magnaporthe grisea 70-15]3e-28
SY0AAB16YD08FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00005895001 annotation :

link to GSTUMT00005895001 Artemis file
link to scaffold_21 sequence file
link to scaffold_21ESTs