Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005865001
Length(AA) : 1020
Localization : scaffold_21
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_13354
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001585837.1| Score: 1733 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ncr:NCU05282.1 Score: 1199 E_value: 1e-129
KOG Definition: Gamma-tubulin complex
Classification: [
Kog Number: KOG2001 Score: 116 E_value: 3e-06
PFAM Definition: Spc97_Spc98, Spc97 / Spc98 family. The spindle pole body (SPB) functions as the microtubule-organising centre in yeast. Members of this family are spindle pole body (SBP) components such as Spc97 and Spc98 that form a complex with gamma-tubulin..
Pfam Number: pfam04130 Score: 134 E_value: 3e-08
Swissprot: Q96RT7|GCP6_HUMAN
Gene Ontology:
GO:0008274 = Cellular component: gamma-tubulin ring complex
GO:0008017 = Molecular function: microtubule binding
GO:0007020 = Biological process: microtubule nucleation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.112NO0.251NO0.087NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7290.0710.208M39

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.0202First60=0.00052PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005865001
MSTSPSSRQARTHSIMTHFSSVFPNPRPFMKYGDKGEEGKEGYPFIIPDL
WKPSCFAPDDSAQPTLFPIAPLQETVLNITKPLDPYKDESEVNLFTFDHD
FAEYFADPDPGSPTEVDSIASTAGEAVEQESSDTSEDIWLRPGSSDLPVN
PRFQTWESFLSAGANNPANPYLSEAGSQVFDAVLTEYVDGSEEITEVVRT
DVLCTCLLHLGLGRNSVLFTYDRKKAEFLSIKPRLRISGCTAGTVDSIIK
SFADCGKKIKQLQKFVDDVGNDSRVATPSTIALADCITAIVESIRQRLSV
DPATISSVLHLHSLMREPSLIIDTFHQIISQTAGISDDSRLLTTLFEVVQ
QEQHRSGWLKPLLMEALARVTRPWLESIEEWIGLGRPAGGEGIGFKGSVE
RGFFVRVEEETYVNERGAERTNRNFIFDKAKVPSFMSAESGESLFESGKS
LRFLQKFHPSHPLSRPGAVEGARAPRLEWKFSWEDLNNLQSQAMSYEREL
RLAIDKYSVQGSTATAPMAGNYQSVPGGIDAFETFGKSKEEIGAMIGKSV
SAMNSPPLSIEHLHKKDLLRTLVLKISRLELNPDPGHDHLTAFAPPISIT
PVLSFSHIFAVQAKIINTACLNMFFKGHKVREHLSLLRKFELFGDGVYSS
RLSHALFGDELDGTEKRGGVHRTGGTMGLKLGSRDSWPPASSELRLALMG
VLDESFDNTQTKGGIHHAGKDGDLPGGLSFGVRDMTMGELERCMDPNGLE
ALDFLKLQYKPPSPLDAIISTTALYQYDRLFKLLLRVLRMLFVVNKLFRD
ATSRGSRWHTVDPVAQKFRIEARHFVDAVCSYMFETGVGSTWRKFEDKLQ
DIERKLDSHDSDLGAEGIESLRVYHESILDRIMFATLSRKRQAPLMKLME
DIFTSILTFAKYSHAKAIGAQTNDEEIPVLYAGFKRRIGIFINVCRGLSE
KRGYGDGVKDSEGRRAVDAIFGSGSKEEGNLLSMLLLKLEMTEYYTDTGK
GEREKIKKGGRGRKGPSDPA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1295 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00005865001 annotation :

link to GSTUMT00005865001 Artemis file
link to scaffold_21 sequence file
link to scaffold_21ESTs