Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005863001
Length(AA) : 401
Localization : scaffold_21
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE60847.1| Score: 407 E_value: 1e-37
KEGG Definition: predicted protein
Accession: aor:AO090012000717 Score: 407 E_value: 5e-38
KOG Definition: No Hit Found
PFAM Definition: DASH_Ask1, DASH complex subunit Ask1. The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro. Components of the DASH complex, including Dam1, Duo1, Spc34, Dad1 and Ask1, are essential and connect the centromere to the plus end of spindle microtubules..
Pfam Number: pfam08655 Score: 275 E_value: 5e-25
Swissprot: Q9P6S5|ASK1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0042729 = Cellular component: DASH complex
GO:0005816 = Cellular component: spindle pole body
GO:0045132 = Biological process: meiotic chromosome segregation
GO:0008104 = Biological process: protein localization
GO:0031134 = Biological process: sister chromatid biorientation
GO:0030437 = Biological process: ascospore formation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.065NO0.182NO0.073NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0710.130.852_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00017First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005863001
MSRPPLSLTAELEKLEQSITLTLQEIDHNFSKAHRIVTTSIIPIVERYAK
ESEAVWEGSKFWKQFFEASANVALSNYQEEEETYEETGVATNAETYITAS
SPGNYGEQSTRITQEDDPRHRETQWENIESPFDALRKDDDADMTFEPTLL
PATPQTSRRTRPAKGSFETPKSSPFYPSAAGAIGKKTPGGANEDQLLHRV
LDKNWRLQATPLGKPPPSRYRTIGAATATTPKAQILPPPGSESPMSSPPK
PHFYSADIFSSPIPGFGGFDGGKKPKPSTTSNTTVLAGDPKTPISRRYGT
AKVTTTHHHELSQQGDEGRFAYGYDDDDDSDDLDLPPGLSPPVTIQFSLP
PSKLLATPAREASRRIVHDILQTAGAADESGATGGSSPPVVRDVGPLDDT
F

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1475 unnamed protein product [Aspergillus oryzae]8e-31


Manual Annotation:

Please find below the necessary files for GSTUMT00005863001 annotation :

link to GSTUMT00005863001 Artemis file
link to scaffold_21 sequence file
link to scaffold_21ESTs