Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005852001
Length(AA) : 332
Localization : scaffold_21
Number of EST contigs matching the gene: 5
Number of ESTs : 77
  User annotation : TmelMAPK_Hog1  [+]

Blast Results:

Nr Definition: Mitogen-activated protein kinase HOG1 (MAP kinase HOG1) gb|AAX86000.1| mitogen-activated protein kinase
Specie: [Alternaria brassicicola]
Accession: sp|Q52PH6|HOG1_ALTBR Score: 1487 E_value: 1e-163
KEGG Definition: mitogen-activated protein kinase sty1 [EC:2.7.11.24]; K04441 p38 MAP kinase
Accession: mgr:MGG_01822 Score: 1459 E_value: 1e-160
KOG Definition: Mitogen-activated protein kinase
Classification: [Signal transduction mechanisms].
Kog Number: KOG0660 Score: 1030 E_value: 1e-112
PFAM Definition: Pkinase, Protein kinase domain..
Pfam Number: pfam00069 Score: 603 E_value: 3e-63
Swissprot: Q52PH6|HOG1_ALTBR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.141NO0.535NO0.116NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1530.1020.725_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00809First60=0.00334PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005852001
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSAKDQLTTQSVAIKK
IMKPFSTPVLSKRTYRELKLLKHLRHENVISLSDIFISPLEDIYFVTELL
GTDLHRLLTSRPLEKQFIQYFLYQILRGLKYVHSAGVVHRDLKPSNILVN
ENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSA
GCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDPYPPLFSIRPVPPK
EGAPTSFREIQKRRSACNRLVGTHAPLAHEYLAPYHDPTDEPVAGEKFDW
SFNDADLPVDTWKIMMYSEILDYHNVDGSAQS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1029 Mitogen-activated protein kinase HOG1 (MAP kinase HOG1)1e-65
Contig2752 Mitogen-activated protein kinase HOG1 (MAP kinase HOG1)0.0
Contig2762 Mitogen-activated protein kinase HOG1 (MAP kinase HOG1)1e-86
SY0AAB21YJ04FM1 Mitogen-activated protein kinase HOG1 (MAP kinase HOG1)3e-45
SY0AAD6YO03FM1 putative MAP kinase [Hypocrea lixii]2e-58


Manual Annotation:

Please find below the necessary files for GSTUMT00005852001 annotation :

link to GSTUMT00005852001 Artemis file
link to scaffold_21 sequence file
link to scaffold_21ESTs