Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005842001
Length(AA) : 369
Localization : scaffold_21
Number of EST contigs matching the gene: 2
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: saccharopine dehydrogenase
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001559795.1| Score: 1138 E_value: 1e-122
KEGG Definition: hypothetical protein
Accession: mgr:MGG_01359 Score: 1088 E_value: 1e-117
KOG Definition: Lysine-ketoglutarate reductase/saccharopine dehydrogenase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG0172 Score: 753 E_value: 2e-80
PFAM Definition: AlaDh_PNT_N, Alanine dehydrogenase/PNT, N-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases..
Pfam Number: pfam05222 Score: 299 E_value: 7e-28
Swissprot: Q7SFX6|LYS1_NEUCR
Gene Ontology:
GO:0004754 = Molecular function: saccharopine dehydrogenase (NAD+
L-lysine-forming) activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.063NO0.141NO0.062NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1160.0580.874_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.50995First60=0.00371PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005842001
MSDKVVLHLRAECKPLEHRSALTPATTSALLNAGYDVRVERSEQRIFDDS
EFEKVGATLVPEGSWTEAPVDHIIIGLKELPDDDFPLKHTHVQFAHCYKN
QGGWENVLSRFPRGKGTLLDLEFLQDDNGRRVAAFGYHAGFAGAALGLEV
WAWQYAHPGEEFRDVKPYSSEGALISRIKSVVTESSADIGRSPRVLVIGA
LGRCGKGAVDLALKVGIPAGNVLQWDMAETAKGGPFVEIVESDIFINCIY
LNQPIPPFVDTKSLENADRKLSVVVDVSCDTTNPHNPIPIYNVNTTFDKP
TVPVSVSGGPPLSVISIDHLPTLLPREASEAFSNDLLPSLLLLKDRKNTR
AWQEAERLFHSKVATLPSS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1913 saccharopine dehydrogenase [Sclerotinia sclerotiorum 1980]1e-99
SY0AAA55YD04FM1 saccharopine dehydrogenase [Sclerotinia sclerotiorum 1980]7e-43


Manual Annotation:

Please find below the necessary files for GSTUMT00005842001 annotation :

link to GSTUMT00005842001 Artemis file
link to scaffold_21 sequence file
link to scaffold_21ESTs