Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005741001
Length(AA) : 1267
Localization : scaffold_20
Number of EST contigs matching the gene: 3
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_11465
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001587473.1| Score: 1605 E_value: 1e-176
KEGG Definition: cohesin
Accession: aor:AO090012000191 Score: 1492 E_value: 1e-163
KOG Definition: Sister chromatid cohesion complex Cohesin
Classification: [
Kog Number: KOG2011 Score: 845 E_value: 1e-90
PFAM Definition: STAG, STAG domain. STAG domain proteins are subunits of cohesin complex - a protein complex required for sister chromatid cohesion in eukaryotes. The STAG domain is present in Schizosaccharomyces pombe mitotic cohesin Psc3, and the meiosis specific cohesin Rec11. Many organisms express a meiosis-specific STAG protein, for example, mice and humans have a meiosis specific variant called STAG3, although budding yeast does not have a meiosis specific version..
Pfam Number: pfam08514 Score: 288 E_value: 5e-26
Swissprot: O13816|SCC3_SCHPO
Gene Ontology:
GO:0000794 = Cellular component: condensed nuclear chromosome
GO:0030892 = Cellular component: mitotic cohesin complex
GO:0007064 = Biological process: mitotic sister chromatid cohesion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.054NO0.140NO0.042NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0950.0790.884_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01483First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005741001
MPSRIASTPPDTMDTSDDTAVAGDSGLVAAEATDENASTAAGVVATLAWS
NDNTQNGAETGNPRRSTRVIKKPILPYSLQLTPPKPSRAKRKRPVEEEEE
EVEEEVGQEDVGGKGGEGENEEDKGGSAENENDNDDDDEGEEEDSEAETT
EESSEEDEDEGEPDEEEKKDRRRKNAAAARGAGGRGDGGGDRAASAPVKR
PPTKKPRTSIAADVAPPARKATTEQAKRAKGKAGDAYCGAESVFEGGDDD
DVAQAWTINYEENSREAMKELVNFILKCCGCHKFVTDYDIEDQDTANTTL
SQIQDAFQRQKNAEYPLASKKPEFRRFRPILASFLHSLITTFAARELLYS
DPGLMEGIEVWITAMSSSTLRQFRHTSTIVALEFVSCLAQIAAEARKANS
TTNRQLEAEKKKSSRNEGRIRALDQKLKDGEERREAIETVIKDIFNIVFV
HRYRDIDAKIRSDCVRELGSWILTLPDLFFDGSYLRYLGWVLSDTTPLTR
LEVVKALTKLFKKKESISNLRHFTERFRPRMVEMAARDADTNVRAAAADL
LDAVREAGYLEPSDIDTVGRLLFDSEPKVRRAVVGFFVANLKDVLQERLG
DLGGEEAVEEALGDDTEDENYEGPTLGWIRLKCLVEALASYDSQDAGDDP
DGQSQVAERSNGAVTRLGDHIESRFSLAGGSLWEEVEEIHDWEITARYLL
YDHSANRLDPGVEEEDVEKRIKSAIALDPREEAILLHILNASVAASIDEG
GELGARKKGTTKRTGKEIEKHYEAVSRRLTKYIPPLLKKFGPDPDAAASV
LRLEQLMKLDVFQELRQSTVYASLLEEINRQFLTHADESVLKEASAAILH
AKTFEELDEVTEQKLSQLKDETVTMLVNAVRGKNLGKGKFSDASLTELIN
TVRRLEYIASITNCVEIMEEPPVASGPKDMLQPVEALIELLRRGGTSDEL
EEELIIRTMKTLEFYFMWKISTLADQEDIDSDKLATRGETVMERIIEITK
TRKKRLATLFIGAGARIGASKPDHNRAANEDEAGTSGASELAVRISALGK
KLDKSVQTDLLKIFEILEKSFANVALKALEPGENDEPADDDEQQPSSEDR
GESNVLLHEQRLCDFTGKLVLAVLSRAIDERVFMKRLVRNKGRLGPNFRE
IVNHLEVEEKPKVAPVVRKLRGRKEELSEVVVDEGGGDEDVEATPRPKAV
SPSKPVAEDVENEGEDEDEGEEEHDPEEPEDLEKIAESSDEESELDPEVD
VPLDGDGDEEMPDADDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4986 hypothetical protein SS1G_11465 [Sclerotinia sclerotiorum 1980]3e-16
Contig6745 hypothetical protein SS1G_11465 [Sclerotinia sclerotiorum 1980]1e-54
SY0AAA59YC21FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00005741001 annotation :

link to GSTUMT00005741001 Artemis file
link to scaffold_20 sequence file
link to scaffold_20ESTs