Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005719001
Length(AA) : 614
Localization : scaffold_20
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001538843.1| Score: 398 E_value: 2e-36
KEGG Definition: hypothetical protein
Accession: ang:An15g06540 Score: 374 E_value: 6e-34
KOG Definition: Predicted E3 ubiquitin ligase
Classification: [Posttranslational modification
Kog Number: KOG2231 Score: 123 E_value: 4e-07
PFAM Definition: Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo..
Pfam Number: pfam05109 Score: 111 E_value: 7e-06
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.065NO0.163NO0.049NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1060.0720.895_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.0034First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005719001
MNVNALLSEAAPTNMNNRTYEYSATSTPYHNNGSIMTPQSLSPSTECKNV
HFRFCNSEPKTLHIYPHDTTDSITTTVKNMFGIKLQDECGLSFQDPEGRY
MILRHENFSDDMTVDIRVEENPASYPQYNLRHPQIMSYTGPGPRGSFSGG
RSVSPSAARGRRSASAGGRPRGMKRQASHRGEEEHYDERFPQGYYLQQPP
QQFLPEEDEESESRSRIEPVASADISLDNIVEGSRRKRPKFSSDELPLFP
PPALPRQDGSTSSSASPSHPAPQVTTPYGNRNISYPHPTPPSTYGFSVSN
GGQPAGAFGQARTNGSTIPTPAPTVASCISDEDVALQLMRLGELPSGSAT
ISTLDETAREEDSFSSECGEFGDDGRSDTAELPDMPPGGPDEGPGSPIIY
PRNHKKYKSLDEILPSFDSTPLPLPAPLPQYPKGTVKAVKRQQPTLSSKP
KSKPKPRSEHHWPISPASPPASRKPSVASVASSKARSNIMTSTNPVANVH
TPMVLLGQQTATPVDENKLHTQYFHNDNNNKLGVEEPIVKPRCQRCRKSK
KGCDRQRPCQRCKDAGIPAGECISEDEAGTRRGRQAAAAAAKKAAGGGLA
GLNKNKAKGKRKRV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig7593 hypothetical protein SNOG_10444 [Phaeosphaeria nodorum SN15]7e-14
SY0AAA58YD09FM1 hypothetical protein CIMG_09527 [Coccidioides immitis RS]3e-06


Manual Annotation:

Please find below the necessary files for GSTUMT00005719001 annotation :

link to GSTUMT00005719001 Artemis file
link to scaffold_20 sequence file
link to scaffold_20ESTs