Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005705001
Length(AA) : 375
Localization : scaffold_2
Number of EST contigs matching the gene: 3
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: predicted protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001542565.1| Score: 361 E_value: 2e-32
KEGG Definition: F-box domain protein
Accession: afm:AFUA_3G13460 Score: 273 E_value: 2e-22
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.050NO0.215NO0.043NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8310.0170.331M373

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02799First60=0.00037PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005705001
MFGSSPADAFEQRAQKIRRAVERARTQFLQKTRPRSANRTSDVLTGSYFD
YLPVELIINICCQTDWRDVTRLRLVSRAFKELVDANESTIATRWMVPGSY
LALLSQLFYPPKSRTGDGVRRPTIQYFCGLEKRHATCSTLAYYLCDKAEG
SSNSDGAEEVDETILIWLIFRYYVLHFLTYSRLRLEANKAAIAAENSDEP
LTPSDLNSAYLSIQSSILATFDNQTLISTHHALHFLVNSIRLSMSPEPPH
KQNDELVAIILRCQMPLNRCVEFFAADCLGASRGLRKQFMQDMEGERADA
EVRFGGGAALRRSISGHSREGSRRKWSPKVTEVWFEAAKIALAERGLQEH
KPDGVYFFPECSQELLIGCPGCKLK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1757 hypothetical protein CIMG_02198 [Coccidioides immitis RS]1e-14
SY0AAD55YC14FM1 hypothetical protein CIMG_02198 [Coccidioides immitis RS]6e-09
SY0AAD58YA02FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00005705001 annotation :

link to GSTUMT00005705001 Artemis file
link to scaffold_2 sequence file
link to scaffold_2ESTs