Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005680001
Length(AA) : 595
Localization : scaffold_2
Number of EST contigs matching the gene: 3
Number of ESTs : 30
  User annotation : TmelPACC  [+]

Blast Results:

Nr Definition: hypothetical protein SNOG_11739
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001801978.1| Score: 711 E_value: 9e-73
KEGG Definition: hypothetical protein
Accession: ani:AN2855.2 Score: 711 E_value: 5e-73
KOG Definition: Zn finger proteins
Classification: [General function prediction only].
Kog Number: KOG3608 Score: 135 E_value: 1e-08
PFAM Definition: No Hit Found
Swissprot: Q00202|PACC_EMENI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.627YES0.857NO0.646YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1520.3820.207S518

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.19414First60=0.18848PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005680001
MCSRKTGLLAVIPSPATAAPVAPSTPAVPSKEDTNLACQWTSCQEKFETP
EDLYNHLCDIHVGRKSTNNLCLTCAWGTCRTTTVKRDHITSHIRVHVPLK
PHKCEFCQKAFKRPQDLKKHVKTHADDSVLLRSPEPDGLGRRASAVHQAR
GDNVHGQYTTGAGMQPLAATAAQAYYGIGAYYPGPNQAPGAAPVYYYNAP
QAPQQDMAQAAPLSENNKKRNYDGMDQFFDDAKRHKIQPVYDGAMAQRLS
ALQFVPTTSEGVDFNGHHAPTVTASPSAQTQFTLPSLRTKQDLIDADNFL
TQLSANVYENPAAATAAGVPAGGAHFTQQYRPNQPSSPHGTPAAQPQQHS
PSHTPVAHDTTSTTAPTIPATSNSTGTPALTPPSQQHSTPPTVSPQTSAS
MYPTLPAAVTSSEMSAGYPAPVSTAPPTSLGPTFESEQRRRISVGVLQKA
SRSSEDTDVDMGTDDIFGNLKKNEISSSLIDPELGALSGETMQQQQQQEE
GPPAAAEKDEIVSWERNIGVINSLRDYVKELLREEDEKEKRGEGEDHIMT
DHDGGVDASNVDQQPQEEGGSDERAKEEQTDAQALYPVLRAVAVA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1190 pH-response transcription factor pacC/RIM101 emb|CAA67063.1| PacC [Aspergillus niger]2e-55
Contig3385 hypothetical protein CIMG_03725 [Coccidioides immitis RS]2e-42
SY0AAC14YB17FM1 hypothetical protein SNOG_11739 [Phaeosphaeria nodorum SN15]2e-13


Manual Annotation:

Please find below the necessary files for GSTUMT00005680001 annotation :

link to GSTUMT00005680001 Artemis file
link to scaffold_2 sequence file
link to scaffold_2ESTs