Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005638001
Length(AA) : 307
Localization : scaffold_2
Number of EST contigs matching the gene: 1
Number of ESTs : 52
  User annotation : Tmel6pgdh  [+]

Blast Results:

Nr Definition: 6-phosphogluconate dehydrogenase, decarboxylating
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001267994.1| Score: 1303 E_value: 1e-142
KEGG Definition: hypothetical protein
Accession: ang:An11g02040 Score: 1293 E_value: 1e-141
KOG Definition: 6-phosphogluconate dehydrogenase
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG2653 Score: 1262 E_value: 1e-139
PFAM Definition: 6PGD, 6-phosphogluconate dehydrogenase, C-terminal domain. This family represents the C-terminal all-alpha domain of 6-phosphogluconate dehydrogenase. The domain contains two structural repeats of 5 helices each..
Pfam Number: pfam00393 Score: 1238 E_value: 1e-137
Swissprot: P53319|6PGD2_YEAST
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0004616 = Molecular function: phosphogluconate dehydrogenase (decarboxylating) activity
GO:0009051 = Biological process: pentose-phosphate shunt
oxidative branch

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.037NO0.182NO0.034NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0760.0680.92_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.94842First60=0.00837PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005638001
MVHNGIEYGDMQLICEAYDIMKRGLRMTNSEIGDVFTNWNTGVLDSFLIE
ITRDIMKYNDPADGTPLVEKILDSAGQKGTGKWTAINALDLGMPVTLIGE
SVFARCLSSIKDERGRAAQVLEGPEIPAFTGDREAAIADLEQALYASKII
SYAQGFMLIREAAKEYNWKLNNPAIALMWRGGCIIRSVFLADITKAYRAK
PDLENLLFDDFFKAAIHQAQPGWRRAIIRGIEFGIPTPCFSTALSFYDGY
RTKDLPANLLQAQRDYFGAHTFRVKPEHQSETLPEGKDIHINWTGRGGNV
SASTYLA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1150 6-phosphogluconate dehydrogenase [Aspergillus niger]0.0


Manual Annotation:

Please find below the necessary files for GSTUMT00005638001 annotation :

link to GSTUMT00005638001 Artemis file
link to scaffold_2 sequence file
link to scaffold_2ESTs