Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005465001
Length(AA) : 877
Localization : scaffold_19
Number of EST contigs matching the gene: 2
Number of ESTs : 11
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CHGG_00728
Specie: [Chaetomium globosum CBS 148.51]
Accession: ref|XP_001219949.1| Score: 1538 E_value: 1e-168
KEGG Definition: hypothetical protein
Accession: fgr:FG09921.1 Score: 1518 E_value: 1e-166
KOG Definition: No Hit Found
PFAM Definition: Fungal_trans, Fungal specific transcription factor domain..
Pfam Number: pfam04082 Score: 210 E_value: 4e-17
Swissprot: P87000|ACU15_NEUCR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.119NO0.267NO0.137NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3440.0860.527_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.0057First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005465001
MPGILPMKLIKCGSSQTRIAQACDRCRSKKIRCDGIRPCCSQCANVGFEC
KTSDKLSRRAFPRGYTESLEERVRCLEQEVREMKDLLDAKDEQLDMLSRI
HSFSPYSPPASAISGGSHRAHKSPESARSGSADLGLDDTFVIHETSSLVG
GSEADGNGAFYVGSSSGRQFLELFKEKSGADFNPDILFGGSQSVKRSEQT
NSHEDTIKTPPRLLSDRLLVSYFQEYHPLFPVIHRPTFLASYKKLVSGGG
SQSNTLPHHSVAQLFLVFAIAQQNEVRPRTDGPDQQFDAQWQRSLNAIIG
DSTIETLQCLVLAQLYCFSLGDYSRLLHYKSLAVGIALRLGLNQSQRKFN
LGALSGEMRKRTFWCVYCLDSFSAAMLGLPKLFKDEDIDTEYPSDIDDEY
VSEKGFSPTLPGDSTKISSALALFRSSRVLSKVLDAVYPTSSSHEVSYTK
LRELEDELGAWKSGLAPHLRLEFVNGTPATNVVDSRSPLLVLAYHYIRSL
IHRPIIGSTLDSKVSASLHMIRESSKCIIQIIQLLTERKLGFSFCLNKTQ
LLLMSGFTLLHSTLDCPQHTPLAKENQRLITGVLEEIESCHPLVAKELRP
IAAAVVNIEPRVAASSRNQHEKPKEHTQSPLTPPLVSPTEQGPLRRRFSS
ISAEFSLRRGKSGDIRRASSQDMSGMGDHGGVRLTSASLTDLSPTPRTRY
PAASHAATVKISQGRQILISDSPYLDGPWDMGSNDLHPNSQNPPPISAYD
WERLLAAMDQTHATHIYGGEDRGSGTFIHPSDSLSAEIGTRPVDQHWSLS
ETPTTASFRGTPPSISSFSTLSEESFTGGDDVRADTGDLDVDSGYTDSDN
LGDFLGPLMGTRSDGSGGVLLENSWHM

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig985 hypothetical protein NCU06656 [Neurospora crassa OR74A]1e-69
Contig1716 hypothetical protein SNOG_10771 [Phaeosphaeria nodorum SN15]3e-62


Manual Annotation:

Please find below the necessary files for GSTUMT00005465001 annotation :

link to GSTUMT00005465001 Artemis file
link to scaffold_19 sequence file
link to scaffold_19ESTs