Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005447001
Length(AA) : 459
Localization : scaffold_19
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_06014
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_369450.2| Score: 787 E_value: 1e-81
KEGG Definition: hypothetical protein [EC:4.2.99.18]; K01741 DNA-(apurinic or apyrimidinic site) lyase
Accession: mgr:MGG_06014 Score: 787 E_value: 5e-82
KOG Definition: Endonuclease III
Classification: [Replication
Kog Number: KOG1921 Score: 853 E_value: 6e-92
PFAM Definition: HhH-GPD, HhH-GPD superfamily base excision DNA repair protein. This family contains a diverse range of structurally related DNA repair proteins. The superfamily is called the HhH-GPD family after its hallmark Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate. This includes endonuclease III, EC:4.2.99.18 and MutY an A/G-specific adenine glycosylase, both have a C terminal 4Fe-4S cluster. The family also includes 8-oxoguanine DNA glycosylases. The methyl-CPG binding protein MBD4 also contains a related domain that is a thymine DNA glycosylase. The family also includes DNA-3-methyladenine glycosylase II EC:3.2.2.21 and other members of the AlkA family..
Pfam Number: pfam00730 Score: 279 E_value: 2e-25
Swissprot: Q09907|END3_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0034042 = Molecular function: 5-formyluracil DNA N-glycosylase activity
GO:0034043 = Molecular function: 5-hydroxymethyluracil DNA N-glycosylase activity
GO:0034039 = Molecular function: 8-oxo-7
8-dihydroguanine DNA N-glycosylase activity
GO:0006285 = Biological process: base-excision repair
AP site formation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.469NO0.896YES0.359NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.9480.0350.039M195

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=4.44668First60=4.44537PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005447001
MARAGRAAARAGAASSLSAVVATTVTRVATTRPTTMQTRAGVPMGDDYSS
SGLSSPPSDLGNYSDEEREVKKEEDEEEGKNGSIVSRFFQSPSPGKGARK
APRKAIALVKKEPTPELGDIAPVLIKEEKEEKKEKGIGQRKPRGKKVKDE
EHVKVEAPENWEEVYEKLREMRKKVKAPVDTMGCERLGDKAATPKLRRFH
TLISLMLSSQTKDTINAVAMKGLREQLPGGLCLESILEVEPKRLDELIRI
VGFHNRKTEYIKKAAVIIRDKHGGDIPDTFEGLTALPGVGPKMAHLCLSA
AWDRTEGIGVDVHVHRICNLWDWVKTTTPEGTREALQAWLPRDKWREINF
LLVGFGQTICLPRGRKCGECALSSGLCGAAYMEPKKVKAKKGKRVIGEDS
DEGFDDDNYAAPERRVRPKRRRVRVEVKEEEEMEVEDEDALVADIEDAVP
NLAKFRYKR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig102 hypothetical protein MGG_06014 [Magnaporthe grisea 70-15]9e-82
Contig3456 hypothetical protein MGG_06014 [Magnaporthe grisea 70-15]5e-61


Manual Annotation:

Please find below the necessary files for GSTUMT00005447001 annotation :

link to GSTUMT00005447001 Artemis file
link to scaffold_19 sequence file
link to scaffold_19ESTs