Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005356001
Length(AA) : 912
Localization : scaffold_19
Number of EST contigs matching the gene: 3
Number of ESTs : 7
  User annotation : Tmelcta3_1  [+]

Blast Results:

Nr Definition: hypothetical protein BC1G_15342
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001546156.1| Score: 1856 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ani:AN6642.2 Score: 1188 E_value: 1e-176
KOG Definition: Ca2+ transporting ATPase
Classification: [Inorganic ion transport and metabolism].
Kog Number: KOG0202 Score: 1065 E_value: 1e-116
PFAM Definition: E1-E2_ATPase, E1-E2 ATPase..
Pfam Number: pfam00122 Score: 480 E_value: 2e-48
Swissprot: P22189|ATC3_SCHPO
Gene Ontology:
GO:0005388 = Molecular function: calcium-transporting ATPase activity
GO:0006816 = Biological process: calcium ion transport
GO:0006874 = Biological process: cellular calcium ion homeostasis

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.082NO0.257NO0.065NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3210.2410.445_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=201.88First60=0.00476PredHel=9
Topology=(90-109,221-238,248-270,606-627,637-659,688-710,728-750,784-806,816-838)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005356001
MAPKKSGPRGPSFSRPPYQLSADELAQELGTNLETGLSPSQAKQGLDQYG
ENKLEGGEGIPVWKVLIKQISNAIIRVLIIAMALSYGVKDWIEGGVITAV
IFLNVTIGFFQEYRAEKTMDSLRSLSSPTAAVLRDGNLDHVASITVVPGD
IVELKTGDVVPADLRLFEAMNFETDEALLTGESLPVPKEPEPPIEGEVGV
GDRTNMAFSSSTKHGNFQPKLAKLAYYLLLCAVVLAIIVFAANKFRIPHE
VVIYAISLGIAIIPESLIAVLTITMAVGMKTMVKRKVIVRKLDALEALGG
VSNICSDKTGTLTQGKMITRKAWIPGLGMYTVDRTEEAANPTSGDFEDGV
LPEIVPELEAFLHSSALCNLATVRFDNTKKRWQATGDPTEIALQNTHSTA
TSRECLSYFRNPTTGDILSLQKVLLRELLIFAHLLMTVLADQGLRVLAIA
RRAIDRPPADWNGFPRNEVEQNLTLMGLAGLYDPPRLETKDAVRKCTNAG
IQVHMLTGDHPSTARAIAREVDQLPALPFVIARCAPNTKVRMIDALHRRG
RYAAMTGDGVNDSPSLKRADVGIAMGLAGSDVAKSASDIVLTDDNFESIV
NAVEEGRRMFDNIQKFILHLLVSNVGEVILLIIGLAFRDRDNFSVFPLAP
LEILWINMLTSSFPAFGLGLEKATSDIMRRPPHDTKVGVFTKQILVDMVV
YGTIMGTCSLCTFVIIVYGVGTGNLGVNCNSRYSSECDLVFRARAAVFAQ
LTWLILISAWEFKSIRRSMFRFDPYQAEHRFPFFRDASTPKVYRNKFLFY
AVVIGAVSVFPVVYIPGLNTGVFKHKGITWEWALSFGAIPVFVCGVEAWK
FIKRKYGLFNNRESDRVKKDASLSLRQGFFTMAKTMTRTSSAGISRSTTV
EKRSPVKGDEMI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1145 unnamed protein product [Aspergillus oryzae]2e-66
Contig5386 hypothetical protein CIMG_00572 [Coccidioides immitis RS]2e-73
Contig7206 hypothetical protein BC1G_15342 [Botryotinia fuckeliana B05.10]1e-107


Manual Annotation:

Please find below the necessary files for GSTUMT00005356001 annotation :

link to GSTUMT00005356001 Artemis file
link to scaffold_19 sequence file
link to scaffold_19ESTs