Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005349001
Length(AA) : 328
Localization : scaffold_19
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_07542
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001240379.1| Score: 1015 E_value: 1e-108
KEGG Definition: zgc:56443; zgc:56443
Accession: dre:406386 Score: 978 E_value: 1e-104
KOG Definition: Protein geranylgeranyltransferase type II
Classification: [
Kog Number: KOG0366 Score: 1191 E_value: 1e-131
PFAM Definition: Prenyltrans, Prenyltransferase and squalene oxidase repeat..
Pfam Number: pfam00432 Score: 141 E_value: 1e-09
Swissprot: P53611|PGTB_HUMAN
Gene Ontology:
GO:0005515 = Molecular function: protein binding
GO:0006464 = Biological process: protein modification process
GO:0007601 = Biological process: visual perception

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.119NO0.267NO0.116NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2930.1590.469_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.16585First60=0.06586PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005349001
MASTLLTSKHVAYIQSLDTKRDRLDYHLTSHLRLSGVYWGLTSLHLLNHP
TALPRSETIDFVKSCYHPSSGGLGASPGHDPHLLYTLSGIQILATIDALD
EIDGDKVVEYVSKLQNPDGSFSGDEWGEVDSRFVYCALSTLSLLGRLGDA
PGVSAEGAVGFVLRCLNADGGFGMAPAAESHAGQIFTCVGALKIAGVFEK
SLSEDQVNLLGDWLCERQLPNGGLNGRPEKLEDVCYSWWVLSSMAMIGKL
QWIDREKLVEFILSCQDEENGGIADRKGDVADVFHTVFGVAGLSLLGYEG
LKEVDPVYCMPKDVTDRIVWNHRKILTT

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2565 hypothetical protein CIMG_07542 [Coccidioides immitis RS]1e-58
Contig4284 PREDICTED: similar to geranylgeranyl transferase II [Gallus gallus]2e-44


Manual Annotation:

Please find below the necessary files for GSTUMT00005349001 annotation :

link to GSTUMT00005349001 Artemis file
link to scaffold_19 sequence file
link to scaffold_19ESTs