Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005322001
Length(AA) : 809
Localization : scaffold_19
Number of EST contigs matching the gene: 3
Number of ESTs : 15
  User annotation : TmelSec10a  [+]

Blast Results:

Nr Definition: hypothetical protein CIMG_02325
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001248554.1| Score: 1617 E_value: 1e-177
KEGG Definition: hypothetical protein
Accession: ncr:NCU09313.1 Score: 1526 E_value: 1e-167
KOG Definition: Exocyst subunit - Sec10p
Classification: [Intracellular trafficking
Kog Number: KOG3745 Score: 907 E_value: 6e-98
PFAM Definition: Sec10, Exocyst complex component Sec10. This family contains the Sec10 component (approximately 650 residues long) of the eukaryotic exocyst complex, which specifically affects the synthesis and delivery of secretory and basolateral plasma membrane proteins..
Pfam Number: pfam07393 Score: 894 E_value: 2e-96
Swissprot: Q06245|SEC10_YEAST
Gene Ontology:
GO:0000145 = Cellular component: exocyst
GO:0005515 = Molecular function: protein binding
GO:0007121 = Biological process: bipolar cellular bud site selection
GO:0006893 = Biological process: Golgi to plasma membrane transport
GO:0006904 = Biological process: vesicle docking during exocytosis
GO:0006906 = Biological process: vesicle fusion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.058NO0.216NO0.069NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6780.0550.28M452

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.21406First60=0.00629PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005322001
MTKSTVAESSRTSRSIYPKPSSFSLSHFSTADFIVKDFIEGLTGSAIPAN
RRSGTNFGTPTFDPKPYIRTFEGALERLKDLDEDLSAKESELKEGVRRAE
MDHARTIDRLSLQFNTTLSEFQRLDSSITDGGGMASRIGGQLEQLEKQHQ
RAEDAKFLIQCYTEFSRGDTSRLEKLRRTPWVEDSIKCAIVSRQLSLIAK
RNEGTAKPGTKELIEAFSESLEQDLLKQFDDAYREFNVPAMKGCAKVLHD
FNGGASVISNFLNQMDFFIAAGKINAGEVVIEDDLKEQLSDPDANPPGLD
PTLLTLIHEIRDVLKMESETIKEVFPYPEAVLGTFLQRVFQQSLQQRLEA
VLEHASNISTLAFLRTLQVSRAHVMTLSDDLKAHGLTEHPGPLSSGTTML
LDQNVEELFTPYLQDRGYMEKEKESLEQLYTGLLFKFHMFHEQRKEQKPL
GVLDRLKKSRERAIEKVLESELAKSQSHALSKIIGFERKAGKDNHLSDVL
LSDADGKLNVEFPKRMLKWLAEAVGRSLELSSQADTPRDVSVMLNILVEN
MRTMYLDVALDAAIEAAEAQTKGEPDLSYLQELKPTTIIMHLMFSFINTA
LTPLSQTSLTIKREMIKLTNSTLSALEQKVNGVIQRTIDIVLAHITLLLS
KQRKADFKPRDDEVRLTTLQTPTCILTTAFLEKLTQTATTSLDGANLTHF
LTEISGGFRTALLEHLKRHSVNQAGGIMLTKDLAKYQEVVNSWKIPAVRD
AFEIVAEIGTLFVVRPTAVRDRMRDGVLAKVKPHLLKPYLSRREDYASAG
IEKILASEL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1189 hypothetical protein MGG_04559 [Magnaporthe grisea 70-15]1e-36
Contig3214 hypothetical protein CIMG_02325 [Coccidioides immitis RS]1e-122
SY0AAB12YP06FM1 hypothetical protein SNOG_04725 [Phaeosphaeria nodorum SN15]1e-35


Manual Annotation:

Please find below the necessary files for GSTUMT00005322001 annotation :

link to GSTUMT00005322001 Artemis file
link to scaffold_19 sequence file
link to scaffold_19ESTs