Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005266001
Length(AA) : 476
Localization : scaffold_18
Number of EST contigs matching the gene: 3
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: serine/threonine protein phosphatase PPT1
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001265966.1| Score: 1813 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An17g00890 Score: 1809 E_value: 0.0
KOG Definition: Serine-threonine phosphatase 2A
Classification: [
Kog Number: KOG0376 Score: 1490 E_value: 1e-166
PFAM Definition: PPP5, PPP5. This domain is specific to the PPP5 subfamily of serine/threonine phosphatases..
Pfam Number: pfam08321 Score: 294 E_value: 3e-27
Swissprot: P53042|PPP5_RAT

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.031NO0.074NO0.031NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0850.0670.9_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.75272First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005266001
MTSASTEALELKAKGNAAIASRDWKTAVDFYTQAIELDPNQALFYSNRAQ
AHIRMEAYGSAIEDAAKAIEIDPASVKAYYRRAISNVALLKYKEALKDFR
TVCKKAPNDKDARLKMNECEKLIRKIDFLKAIEQSDPPSAAEGLDLDSIV
VENEYDGVRLEKEMTQEFIDDMIERFKNGKTIHKKYAYQIILKAKEIFYA
EPTMPEVTIPDGNKMTICGDTHGQYFDLLEIFRRNGFPAETHAYLFNGDF
VDRGSWSTEIAFLLFSYKWLFPNNFYINRGNHETDDMNRVYGFEGECKAK
YNERMFKLFSEAFSALPLATLVGSKYLVLHGGLFSDDKVNLDDIRKLNRH
LKKQPGQEGLMMEMLWTDPQPDPGRRPSKRGVGQQFGPDVTKSFCERNGL
EAIIRSHEVRMGGYEVEHDGRCITVFSAPNYVDTSGNKGAYINVGSDYKL
EHNVFDAVEHPPIKAMAYAQNSLMSM

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1131 serine/threonine protein phosphatase PPT1 [Aspergillus fumigatus Af293]1e-176
SY0AAC50YP11FM1 hypothetical protein BC1G_15048 [Botryotinia fuckeliana B05.10]2e-22
SY0AAD36YA10FM1 hypothetical protein SS1G_13212 [Sclerotinia sclerotiorum 1980]2e-17


Manual Annotation:

Please find below the necessary files for GSTUMT00005266001 annotation :

link to GSTUMT00005266001 Artemis file
link to scaffold_18 sequence file
link to scaffold_18ESTs