Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005184001
Length(AA) : 500
Localization : scaffold_18
Number of EST contigs matching the gene: 1
Number of ESTs : 16
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_06540
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001555017.1| Score: 918 E_value: 8e-97
KEGG Definition: hypothetical protein
Accession: mgr:MGG_06327 Score: 910 E_value: 3e-96
KOG Definition: Aspartyl protease
Classification: [Posttranslational modification
Kog Number: KOG1339 Score: 397 E_value: 5e-39
PFAM Definition: Asp, Eukaryotic aspartyl protease. Aspartyl (acid) proteases include pepsins, cathepsins, and renins. Two-domain structure, probably arising from ancestral duplication. This family does not include the retroviral nor retrotransposon proteases (pfam00077), which are much smaller and appear to be homologous to a single domain of the eukaryotic asp proteases..
Pfam Number: pfam00026 Score: 673 E_value: 5e-71
Swissprot: P22929|CARP_SACFI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.710YES0.915YES0.689YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0720.7190.213S320

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.11357First60=0.01833PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005184001
MKFTGLLCSSALAFWENTLALHLHPPSENAGKTLSFGFQKVKRNVDNIPR
LRKRDSPNTVGQRLDNLDYLYYANISVGTPPQKLRLHLDTGSSDVWVETM
NSYICQRPQRPCRRTGTFNPDGSSTYEKVSDDFDISYVDGEYARGEYGKD
VFTLSGGVKVAGLQFGVGLESTSTDGIMGIGFSLNEVQVQRLGKDPYRNL
VDLMVDQKLIRSRAYSMWLNDLDATTGEVLFGGVDTAKFTGSLTTLPMDK
RVGEAKAREFAITLTSVSIANSSGGSLTLTANGYASPVVLDSGSTYTYLD
PNLAKELGDQVGAQPLDQYGVAVVPCEVRGYNGSVTYGFSGATITVPLRE
LVVDARDRSGKPVRFSDGTPLCYWGILSSGDLGTNVMGDTFLRSAYVVFD
LDNEEISLANTLYNVTDSRIREIGTGRSAVPDATGAPSAVTVLASGTGIN
RGNARPYISETMTRNSPPDPTGTANPAPSLNPSFASTLLLFTTVTISLVL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1640 hypothetical protein BC1G_06540 [Botryotinia fuckeliana B05.10]1e-96


Manual Annotation:

Please find below the necessary files for GSTUMT00005184001 annotation :

link to GSTUMT00005184001 Artemis file
link to scaffold_18 sequence file
link to scaffold_18ESTs