Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005143001
Length(AA) : 308
Localization : scaffold_18
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : MANTUM00005143001  [+]

Blast Results:

Nr Definition: hypothetical protein CIMG_02601
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001248830.1| Score: 807 E_value: 3e-84
KEGG Definition: hypothetical protein
Accession: ang:An15g00110 Score: 770 E_value: 3e-80
KOG Definition: Mitochondrial FAD carrier protein
Classification: [Energy production and conversion].
Kog Number: KOG0764 Score: 769 E_value: 2e-82
PFAM Definition: Mito_carr, Mitochondrial carrier protein..
Pfam Number: pfam00153 Score: 231 E_value: 4e-20
Swissprot: Q9H2D1|MFTC_HUMAN
Gene Ontology:
GO:0005743 = Cellular component: mitochondrial inner membrane
GO:0008517 = Molecular function: folic acid transporter activity
GO:0015884 = Biological process: folic acid transport

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.416NO0.729NO0.389NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0150.7760.46S429

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=64.1221First60=22.0335PredHel=1
Topology=(7-29)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005143001
MKEHQNWIPSILVETIAGFTAGFLSTLVAHPLDLVKVRLQVDRESRTPKL
GATWRIARNVVANEGRGALYRGFSPNLAGNMTSWGLFFMLYGEIKSRVTN
HKQGGLSSIDYLLSSGTAGVLTAICTNPLWVVKTRMLSSGRSVPGAYLGL
TDGLRTILRDEGTRGLFRGLVPALFGVGQGALQFMFYEELKLWRRRLRER
NNSISDGGGDGRSEKVGGGLSNTDFLTLSAASKILSGSIIYPYRVVQTRM
QTYDADAVYSSARDAVVKIWRREGLTGFYKGLAPNLARVLPSTCITFLVY
ENTRYYLQ

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1350 mitochondrial folate carrier protein Flx1, putative [Aspergillus clavatus NRRL 1]6e-22
SY0AAA19YB07FM1 hypothetical protein CIMG_02601 [Coccidioides immitis RS]1e-54


Manual Annotation:

Please find below the necessary files for GSTUMT00005143001 annotation :

link to GSTUMT00005143001 Artemis file
link to scaffold_18 sequence file
link to scaffold_18ESTs