Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005113001
Length(AA) : 1557
Localization : scaffold_18
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG07168.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_387344.1| Score: 2246 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: fgr:FG07168.1 Score: 2246 E_value: 0.0
KOG Definition: Tuberin - Rap/ran-GTPase-activating protein
Classification: [Cell cycle control
Kog Number: KOG3687 Score: 727 E_value: 8e-77
PFAM Definition: Rap_GAP, Rap/ran-GAP..
Pfam Number: pfam02145 Score: 382 E_value: 8e-37
Swissprot: Q9UUG9|TSC2_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0033596 = Cellular component: TSC1-TSC2 complex
GO:0005515 = Molecular function: protein binding
GO:0006995 = Biological process: cellular response to nitrogen starvation
GO:0006886 = Biological process: intracellular protein transport
GO:0043091 = Biological process: L-arginine import
GO:0009935 = Biological process: nutrient import
GO:0043087 = Biological process: regulation of GTPase activity
GO:0031929 = Biological process: TOR signaling pathway

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.048NO0.149NO0.060NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1710.0430.877_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00601First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005113001
MPSTPGSTDPPQLQDSTKVPLGIAGVFRSLRRLNPGPPNPVPATPAAPPS
NGNRPGEHFNEEAVASGQVLVDKLRANNSLNDRISAAEALRTIVADYPAS
AVTEIWTNAQDLTNEENPPEARQAAFKLLTACIKQYEPSALDRIKLYRTV
ALHSYPEDFFHQLQALIALTNGGRDLSTFQREIGGLLSRWLRTWFKESTI
IRQTRKRDRTTSEILSSEEFCLKELFQFTTDIIKFNFKSFEEREVNQLLT
DVLSICRKTTSKKDIECSIAFIETLIAYGYVPRPALKPCIEVLCGAYATL
RDLTDATWNAVSNLCKSYMAHNSILVLREILEAPANNPPGSSNTNTLRGA
VWFLEKLLIANETDGLPSVQFTVVMSAFQSALSADSMRLELEISRAIAAI
LGSKDVVSQISSDEWSVPLSILVHCSRRATRLNHGSTREGLESDDTPHPY
ENDGVGAAISHALTQIITLLEVACLNPEFEQTEEVMGFFTRVHSHLPNSA
AELVINYYSTEHLCYPSCGEWLDNCRQLLNAFFRARTRPPSMRISVLHLI
KGVYETIRDVCEDEVLHALVVSVLEDFQNEKDLKVLDALIKTVVDISSHT
SMKLFEILLALFVEYIGLDGGLPDLPPPGQGSGASTKSLICPTANARSSQ
GPQKNIVTRGLVRIFIKNMNTNAAKSVLVYEQLVKISGSVDLDPSARLTA
MRLLFRLRADSENAIFIMENPGSDYLASVLHRMTKVADETASMVSKGDGE
SSSSSRSNRSNSASQTPFLLRNSSRPAAEKHDHPKRMPQIWSYPEPKALP
EKPMHLASPVLVTFYDPPLDFPSREGPSLDPRLCIRMSLWMEKVIPIIQQ
GCDWEIYSYVLVHLSSQLSNKTAFRNCKAHIKMLRSYVCDQLHTNRIPNT
DLSPEVKKADIAVVLINLLTTLISYKQHFAKNETEGIVKAFQLGLHSWQR
TAKPCIHALSICCYELSGSTSKFLPGILTKLSQIITSSAVSVHILEFLSA
LAKLPKLYSNFTEPDFRNIFGIAFRYIQHTKETTAQQQLIKVTPASRPSQ
SQANPADLTAQTEQPDLPQYVLTLAYNVLTTWFLSLRLPERPKYVSWITR
GLVLHDQSNTVDEQSQACIDMLQRFTFSDIDLKPPNKIETQKSGTVSKNW
LHSSSILSIQTAPDSGISRVVVRRAPESRDPHSMLQSKWANIQEDVDSLA
YAATGVEQKQDRVLPSHFLLQIAGGLGPSEARPILLPEDEKTLRALDVFD
RIPVVDFHKIGVVYVAAGQTEEKDILSNAMGSPDYTDFIDGLGDLIALKG
TDINTGGLDRENNLDGEFAFFWSDRITQIIFHITTMMPMVDGDPQCTMKK
RHIGNDFVNIVFNNSGLPWRFGTIPSQFNFVSIIITPEARSGFVSSRLLR
KGSGDRTFYRVQMVCKEGFSEISPAQEPKIVSESSLPAFVRNLALNASVY
SYVYNEGGGEHISNWRHRLRSIAKLRERTSAASPGLGGNGGPIGSGGGGT
TSPGQNSTAPGSRRVSTMSAQTSVSDHSYRNSAHMNGDTDQSETEDLLMS
LDFSRFT

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6223 hypothetical protein SNOG_01675 [Phaeosphaeria nodorum SN15]4e-56
SY0AAB41YA11FM1 unnamed protein product [Aspergillus oryzae]7e-26
SY0AAC39YP22FM1 GTPase activating protein (Tsc2), putative [Aspergillus fumigatus A1163]7e-23


Manual Annotation:

Please find below the necessary files for GSTUMT00005113001 annotation :

link to GSTUMT00005113001 Artemis file
link to scaffold_18 sequence file
link to scaffold_18ESTs