Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005090001
Length(AA) : 1080
Localization : scaffold_17
Number of EST contigs matching the gene: 5
Number of ESTs : 17
  User annotation : No user annotation

Blast Results:

Nr Definition: nucleolar protein
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001559651.1| Score: 1588 E_value: 1e-174
KEGG Definition: ribosome biogenesis protein - Nop58p/Nop5p
Accession: aor:AO090012000796 Score: 1517 E_value: 1e-166
KOG Definition: Ribosome biogenesis protein - Nop58p/Nop5p
Classification: [RNA processing and modification
Kog Number: KOG2572 Score: 1573 E_value: 1e-175
PFAM Definition: Nop, Putative snoRNA binding domain. This family consists of various Pre RNA processing ribonucleoproteins. The function of the aligned region is unknown however it may be a common RNA or snoRNA or Nop1p binding domain. Nop5p (Nop58p) from yeast is the protein component of a ribonucleoprotein protein required for pre-18s rRNA processing and is suggested to function with Nop1p in a snoRNA complex. Nop56p and Nop5p interact with Nop1p and are required for ribosome biogenesis. Prp31p is required for pre-mRNA splicing in S. cerevisiae..
Pfam Number: pfam01798 Score: 556 E_value: 3e-57
Swissprot: Q12499|NOP58_YEAST
Gene Ontology:
GO:0031428 = Cellular component: box C/D snoRNP complex
GO:0032040 = Cellular component: small subunit processome
GO:0017069 = Molecular function: snRNA binding
GO:0000154 = Biological process: rRNA modification
GO:0006608 = Biological process: snRNP protein import into nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.193NO0.367NO0.136NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0750.1560.875_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=22.9093First60=0.00054PredHel=1
Topology=(753-775)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005090001
MTFLILTETSAGYALFKAKDKKLLKKDDLAKEMSTPEGAASLVRLKQFSK
FDSAAAALEEVSCIVENKVSPMLSSLLNSVKDEKKASLVVADPKLGNAIN
KLPGLSFQIISDSSTNDLYRAIREHLTALIPGLTPNDVSTMSLGLSHSLS
RHKLKFSPDKVDTMIVQAIALLDDLDKELNIYAMRVKEWYGWHFPEMGKI
INDNLAYAKVIKAMGMRTSAATTDLAEILPEEIETALKAAAEVSMGTEIT
AEDLNNITLLADQVISFTEYRQQLSSYLSARMTAIAPNLTALVGELVGAR
LIAHAGSLMNLAKSPASTVQILGAEKALFRALKTKHDTPKYGLIYHASLI
GQSTGKNKGKIARMLATKTALGLRVDALADDKDGSATLGLEMRAMIENRV
RKLEGKPAVPRGNANTTSIVSLRAPGKWEIKEAKKYNPDADTAMEDTLPA
AQAVAEAAVRAIGQDIAMGDDDEESSEDGEEAEKTEKGKNSLVPVIPTSK
DDKEGESNGDDEDEEAKRKAEKKARKEAKKSKSSSKKRRKSEGSWGAAAS
NTDHMSAHSLHASVLILPNPQLSSPEHLAYVPRVKKNITFAIDISANIRT
LHTGVASQGDDISGLLYVPMVNETTTCHGLSSVPTNVTHKDDLPDAIYDL
IAFAPWMSRDCSTRFLKAAQVDASVVKGFIFYLDDKAAKIPEVKDPYWHG
VPFDNFEFPIYAIPGRDGIPLLDKIAEYSGNMSEVWEAQNLTSYYDPKDF
ARVYMEVDTGHRNPLPGLWLFLLIVLGVLLGIVGLTSLSMHMLQYRHLQG
LRRRVANGQVDLEALGIKRLSVPRRILEKFPIRIYVPEPTSPTIPASTYS
LPVSPRPTRSISNPPRTPPPVRYFAPPDPPLPPSPTPARRRQSRDRRNDP
VHDTTLQRGYSQSQCSICLDDFIPYSTAVRELPCLHVFHPDCIDPFLETQ
SSLCPLCKVSALPRGYVPPQLTNATVRRERNLRRMRARVDAGGGVLSWWA
RLRFRISSSRHEEEERDLRNTARMAVARNNPVTEISEYSRGSSRLPADSP
GESHVDDEEVGENNRSRWRKAMKTLFPGFG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig415 nucleolar protein [Botryotinia fuckeliana B05.10]8e-97
Contig1581 hypothetical protein SS1G_05796 [Sclerotinia sclerotiorum 1980]3e-14
Contig1652 hypothetical protein SS1G_05796 [Sclerotinia sclerotiorum 1980]2e-18
Contig2341 hypothetical protein SS1G_05796 [Sclerotinia sclerotiorum 1980]6e-40
SY0AAB47YA04FM1 nucleolar protein [Botryotinia fuckeliana B05.10]8e-13


Manual Annotation:

Please find below the necessary files for GSTUMT00005090001 annotation :

link to GSTUMT00005090001 Artemis file
link to scaffold_17 sequence file
link to scaffold_17ESTs